Transcription Factor
| Accessions: | T23425 (AthalianaCistrome v4_May2016), Q9SNW9 (JASPAR 2024) |
| Names: | AT5G62320, MYB99, T23425;, Myb domain protein 99, Myb family transcription factor, MYB transcription factor, Putative transcription factor, Q9SNW9_ARATH, Transcription factor-like |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:MYB |
| Length: | 245 |
| Pfam Domains: | 15-69 Myb-like DNA-binding domain 18-85 Myb-like DNA-binding domain 75-119 Myb-like DNA-binding domain 78-126 Myb-like DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MGGRKPCCDEVGLRKGPWTVEEDGKLVDFLRARGNCGGGGGGWCWRDVPKLAGLRRCGKS 60 61 CRLRWTNYLRPDLKRGLFTEEEIQLVIDLHARLGNRWSKIAVELPGRTDNDIKNYWNTHI 120 121 KRKLIRMGIDPNTHRRFDQQKVNEEETILVNDPKPLSETEVSVALKNDTSAVLSGNLNQL 180 181 ADVDGDDQPWSFLMENDEGGGGDAAGELTMLLSGDITSSCSSSSSLWMKYGEFGYEDLEL 240 241 GCFDV |
| Interface Residues: | 57, 59, 60, 62, 63, 67, 68, 109, 110, 113, 114, 117, 118, 119 |
| 3D-footprint Homologues: | 2kdz_A, 3zqc_A, 1mse_C, 6kks_A, 3osg_A, 7xur_A |
| Binding Motifs: | M0526 yyyACCTAmyt M0544 hyyyACCwAmyyh MA2008.1 / UN0368.1 yyCACCTAmy MA2008.2 CACCTAmy |
| Binding Sites: | MA2008.2.13 / MA2008.2.20 / MA2008.2.4 / MA2008.2.5 / MA2008.2.7 MA2008.1.1 / UN0368.1.1 MA2008.1.11 / UN0368.1.10 MA2008.1.12 / UN0368.1.11 MA2008.1.13 / MA2008.1.7 / UN0368.1.12 / UN0368.1.6 UN0368.1.13 MA2008.1.14 / UN0368.1.14 MA2008.1.15 / UN0368.1.15 MA2008.1.16 / UN0368.1.16 MA2008.1.17 / UN0368.1.17 MA2008.1.18 / MA2008.1.9 / UN0368.1.18 / UN0368.1.8 UN0368.1.19 MA2008.1.3 / UN0368.1.2 MA2008.1.19 / UN0368.1.20 MA2008.1.4 / UN0368.1.3 MA2008.1.5 / UN0368.1.4 MA2008.1.6 / UN0368.1.5 MA2008.1.8 / UN0368.1.7 MA2008.1.10 / UN0368.1.9 MA2008.1.2 MA2008.1.20 MA2008.2.18 / MA2008.2.3 / MA2008.2.9 MA2008.2.1 MA2008.2.10 / MA2008.2.15 MA2008.2.11 / MA2008.2.12 / MA2008.2.14 / MA2008.2.6 / MA2008.2.8 MA2008.2.16 MA2008.2.17 MA2008.2.19 MA2008.2.2 |
| Publications: | Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.