Transcription Factor

Accessions: 1cdw_A (3D-footprint 20231221)
Names: TATA BINDING PROTEIN (TBP), TATA sequence-binding protein, TATA-binding factor, TATA-box factor, TATA-box-binding protein, TBP_HUMAN, Transcription initiation factor TFIID TBP subunit
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20226
Length: 179
Pfam Domains: 5-87 Transcription factor TFIID (or TATA-binding protein, TBP)
93-177 Transcription factor TFIID (or TATA-binding protein, TBP)
Sequence:
(in bold interface residues)
1 SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGK 60
61 MVCTGAKSEENSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQ 120
121 QFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Interface Residues: 9, 11, 39, 40, 54, 56, 62, 64, 98, 99, 101, 130, 131, 145, 147, 153, 155
3D-footprint Homologues: 6cnb_R, 1cdw_A, 5iy6_P, 7z7n_D, 1qna_B, 5n9g_G, 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D
Binding Motifs: 1cdw_A TATAAaAg
Binding Sites: 1cdw_B
1cdw_C
Publications: Nikolov D.B, Chen H, Halay E.D, Hoffman A, Roeder R.G, Burley S.K. Crystal structure of a human TATA box-binding protein/TATA element complex. Proceedings of the National Academy of Sciences of the United States of America 93:4862-7 (1996). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.