Transcription Factor

Accessions: 4l18_F (3D-footprint 20250804), 5zmc_B (3D-footprint 20250804)
Names: ETS1_HUMAN, p54, Protein C-ets-1
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14921
Length: 106
Pfam Domains: 4-85 Ets-domain
Sequence:
(in bold interface residues)
1 SGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSR 60
61 GLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Interface Residues: 1, 34, 38, 39, 42, 56, 57, 59, 60, 61, 63, 64, 78
3D-footprint Homologues: 3zp5_A, 2wbs_A, 8smh_F, 4uno_A, 8smj_F, 1dux_F, 7jsa_J, 3jtg_A, 8ee9_F, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 1awc_A
Binding Motifs: 4l18_EF AGGATGTGGCTT
5zmc_B CTTCCG
Binding Sites: 4l18_G
4l18_H
5zmc_C
5zmc_D
Publications: Shrivastava T, Mino K, Babayeva N.D, Baranovskaya O.I, Rizzino A, Tahirov T.H. Structural basis of Ets1 activation by Runx1. Leukemia 28:2040-8 (2014). [Pubmed]

Xu X, Li Y, Bharath SR, Ozturk MB, Bowler MW, Loo BZL, Tergaonkar V, Song H. Structural basis for reactivating the mutant TERT promoter by cooperative binding of p52 and ETS1. Nat Commun 9:3183 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.