Transcription Factor

Accessions: 4cyc_B (3D-footprint 20260701)
Names: Dpbx, EXD_DROME, HOMEOBOX PROTEIN EXTRADENTICLE
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P40427
Length: 58
Pfam Domains: 2-56 Homeobox domain
15-53 Homeobox KN domain
Sequence:
(in bold interface residues)
1 RNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
Interface Residues: 41, 42, 44, 45, 48, 49, 51, 52, 53, 56
3D-footprint Homologues: 2ld5_A, 8ik5_C, 5jlw_D, 4j19_B, 1ig7_A, 8pi8_B, 7q3o_C, 8osb_E, 1le8_A, 5zfz_A, 2r5y_A, 1puf_B, 8eml_B, 6fqp_B, 5flv_I, 3lnq_A, 1le8_B, 1b72_A, 5zjt_E, 4qtr_D, 3a01_E, 1zq3_P, 8g87_X, 1jgg_B, 6fqq_E, 5hod_A, 3rkq_B, 8pmf_A, 1mnm_C, 8bx1_A, 1du0_A, 6a8r_A, 4xrm_B, 3cmy_A, 2d5v_B, 1k61_B, 6m3d_C, 4cyc_A, 2lkx_A, 9b8u_A, 1puf_A, 8ejp_B, 1fjl_B, 6es3_K, 4xrs_G, 3d1n_M, 2hdd_A, 7psx_B, 2hos_A
Binding Motifs: 4cyc_AB gTGAatTA
4cyc_B wnTCAc
Binding Sites: 4cyc_C
4cyc_D
Publications: Foos N, Maurel-Zaffran C, Maté M.J, Vincentelli R, Hainaut M, Berenger H, Pradel J, Saurin A.J, Ortiz-Lombardía M, Graba Y. A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. Structure (London, England : 1993) 23:270-9 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.