Transcription Factor
| Accessions: | 4cyc_B (3D-footprint 20260701) |
| Names: | Dpbx, EXD_DROME, HOMEOBOX PROTEIN EXTRADENTICLE |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P40427 |
| Length: | 58 |
| Pfam Domains: | 2-56 Homeobox domain 15-53 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 RNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI |
| Interface Residues: | 41, 42, 44, 45, 48, 49, 51, 52, 53, 56 |
| 3D-footprint Homologues: | 2ld5_A, 8ik5_C, 5jlw_D, 4j19_B, 1ig7_A, 8pi8_B, 7q3o_C, 8osb_E, 1le8_A, 5zfz_A, 2r5y_A, 1puf_B, 8eml_B, 6fqp_B, 5flv_I, 3lnq_A, 1le8_B, 1b72_A, 5zjt_E, 4qtr_D, 3a01_E, 1zq3_P, 8g87_X, 1jgg_B, 6fqq_E, 5hod_A, 3rkq_B, 8pmf_A, 1mnm_C, 8bx1_A, 1du0_A, 6a8r_A, 4xrm_B, 3cmy_A, 2d5v_B, 1k61_B, 6m3d_C, 4cyc_A, 2lkx_A, 9b8u_A, 1puf_A, 8ejp_B, 1fjl_B, 6es3_K, 4xrs_G, 3d1n_M, 2hdd_A, 7psx_B, 2hos_A |
| Binding Motifs: | 4cyc_AB gTGAatTA 4cyc_B wnTCAc |
| Binding Sites: | 4cyc_C 4cyc_D |
| Publications: | Foos N, Maurel-Zaffran C, Maté M.J, Vincentelli R, Hainaut M, Berenger H, Pradel J, Saurin A.J, Ortiz-LombardÃa M, Graba Y. A flexible extension of the Drosophila ultrabithorax homeodomain defines a novel Hox/PBC interaction mode. Structure (London, England : 1993) 23:270-9 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.