Transcription Factor
| Accessions: | P17019 (JASPAR 2024) |
| Names: | Zinc finger protein 15, Zinc finger protein 15-like 1, Zinc finger protein 708, Zinc finger protein KOX8, ZN708_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P17019 |
| Length: | 563 |
| Pfam Domains: | 4-44 KRAB box 156-177 Zinc-finger double domain 168-190 Zinc finger, C2H2 type 168-186 C2H2-type zinc finger 183-206 Zinc-finger double domain 195-215 C2H2-type zinc finger 196-218 C2H2-type zinc finger 196-218 Zinc finger, C2H2 type 210-234 Zinc-finger double domain 223-243 C2H2-type zinc finger 224-246 C2H2-type zinc finger 224-246 Zinc finger, C2H2 type 239-262 Zinc-finger double domain 251-274 C2H2-type zinc finger 252-274 Zinc finger, C2H2 type 252-274 C2H2-type zinc finger 266-291 Zinc-finger double domain 279-300 C2H2-type zinc finger 280-302 Zinc finger, C2H2 type 280-302 C2H2-type zinc finger 294-318 Zinc-finger double domain 307-328 C2H2-type zinc finger 308-330 Zinc finger, C2H2 type 308-330 C2H2-type zinc finger 322-346 Zinc-finger double domain 335-355 C2H2-type zinc finger 336-358 Zinc finger, C2H2 type 336-358 C2H2-type zinc finger 351-374 Zinc-finger double domain 363-383 C2H2-type zinc finger 364-383 C2H2-type zinc finger 364-386 Zinc finger, C2H2 type 378-402 Zinc-finger double domain 391-411 C2H2-type zinc finger 392-411 C2H2-type zinc finger 392-414 Zinc finger, C2H2 type 407-430 Zinc-finger double domain 419-439 C2H2-type zinc finger 435-459 Zinc-finger double domain 447-468 C2H2-type zinc finger 448-470 C2H2-type zinc finger 448-470 Zinc finger, C2H2 type 462-485 Zinc-finger double domain 475-489 C2H2-type zinc finger 476-498 C2H2-type zinc finger 476-498 Zinc finger, C2H2 type 490-514 Zinc-finger double domain 503-523 C2H2-type zinc finger 504-526 Zinc finger, C2H2 type 504-526 C2H2-type zinc finger 519-542 Zinc-finger double domain 531-552 C2H2-type zinc finger 532-554 Zinc finger, C2H2 type 532-554 C2H2-type zinc finger 546-563 Zinc-finger double domain |
| Sequence: (in bold interface residues) | 1 MGPLTFMDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSNLDLITCLEQGK 60 61 EPWNMKRHEMAAKPPAMCSHFAKDLRPEQYIKNSFQQVILRRYGKCGYQKGCKSVDEHKL 120 121 HKGGHKGLNRCVTTTQSKIVQCDKYVKVFHKYSNAKRHKIRHTGKNPFKCKECGKSFCML 180 181 SQLTQHEIIHTGEKPYKCEECGKAFKKSSNLTNHKIIHTGEKPYKCEECGKAFNQSSTLT 240 241 RHKIIHTGEKLYKCEECGKAFNRSSNLTKHKIVHTGEKPYKCEECGKAFKQSSNLTNHKK 300 301 IHTGEKPYKCGECGKAFTLSSHLTTHKRIHTGEKPYKCEECGKAFSVFSTLTKHKIIHTE 360 361 EKPYKCEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLTYHKVIHTGKKPY 420 421 KCEECGKAFSIFSILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEE 480 481 CGKSFILSSHLTTHKIIHTGEKPYKCKECGKAFNQSSTLMKHKIIHTGEKPYKCEECGKA 540 541 FNQSPNLTKHKRIHTKEKPYKCK |
| Interface Residues: | 159, 179, 181, 182, 184, 185, 206, 207, 208, 209, 210, 213, 214, 217, 234, 235, 236, 237, 238, 239, 241, 242, 262, 263, 264, 265, 266, 268, 269, 271, 273, 290, 291, 292, 293, 294, 297, 318, 319, 320, 321, 322, 324, 325, 327, 328, 329, 331, 347, 348, 349, 350, 351, 353, 374, 375, 376, 377, 378, 380, 381, 402, 403, 404, 405, 406, 408, 409, 430, 431, 432, 433, 434, 437, 459, 460, 461, 462, 465, 471, 476, 485, 487, 488, 489, 490, 492, 493, 497, 514, 515, 516, 517, 518, 521, 542, 543, 544, 545, 546, 549 |
| 3D-footprint Homologues: | 2lt7_A, 5und_A, 1tf3_A, 1tf6_A, 2i13_A, 5k5i_A, 8ssu_A, 4m9v_C, 7n5w_A, 7txc_E, 5ei9_F, 8gn3_A, 8h9h_G, 7eyi_G, 5yel_A, 1ubd_C, 5kkq_D, 1mey_C, 7w1m_H, 2drp_D, 6ml4_A, 6blw_A, 6e94_A, 8cuc_F, 7y3l_A, 6u9q_A, 4x9j_A, 5kl3_A, 1f2i_J, 2gli_A, 1g2f_F, 5yj3_D, 8ssq_A, 5v3j_F, 2jpa_A, 2wbs_A, 7ysf_A, 3uk3_C, 1llm_D, 6jnm_A, 6wmi_A, 6a57_A, 2kmk_A, 7y3m_I |
| Binding Motifs: | MA1730.1 / UN0339.1 ccrGCTGTrCCTccy MA1730.2 GCTGTrCCT |
| Binding Sites: | MA1730.1.1 / UN0339.1.1 MA1730.1.10 / UN0339.1.10 MA1730.1.11 / UN0339.1.11 MA1730.1.12 / UN0339.1.12 UN0339.1.13 MA1730.1.13 / UN0339.1.14 MA1730.1.14 / UN0339.1.15 MA1730.1.15 / UN0339.1.16 UN0339.1.17 MA1730.1.17 / UN0339.1.18 MA1730.1.18 / UN0339.1.19 MA1730.1.2 / UN0339.1.2 MA1730.1.19 / UN0339.1.20 MA1730.1.3 / UN0339.1.3 MA1730.1.4 / UN0339.1.4 MA1730.1.6 / UN0339.1.5 MA1730.1.7 / UN0339.1.6 MA1730.1.8 / UN0339.1.7 MA1730.1.9 / UN0339.1.8 UN0339.1.9 MA1730.1.16 MA1730.1.20 MA1730.1.5 MA1730.2.1 / MA1730.2.3 MA1730.2.10 / MA1730.2.19 / MA1730.2.20 / MA1730.2.9 MA1730.2.11 / MA1730.2.14 / MA1730.2.17 / MA1730.2.7 MA1730.2.12 / MA1730.2.6 MA1730.2.13 MA1730.2.15 MA1730.2.16 MA1730.2.18 MA1730.2.2 MA1730.2.4 MA1730.2.5 MA1730.2.8 |
| Publications: | Imbeault M, Helleboid PY, Trono D. KRAB zinc-finger proteins contribute to the evolution of gene regulatory networks. Nature 543:550-554 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.