Transcription Factor

Accessions: ZNF143_DBD (HumanTF 1.0)
Names: Fragment, Q9H176_HUMAN, ZNF143, ZNF143 protein
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q9H176
Notes: Ensembl ID: ENSG00000166478; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Megaman
Length: 247
Pfam Domains: 18-42 Zinc finger, C2H2 type
18-42 C2H2-type zinc finger
34-61 Zinc-finger double domain
48-72 Zinc finger, C2H2 type
48-72 C2H2-type zinc finger
65-91 Zinc-finger double domain
78-102 Zinc finger, C2H2 type
78-102 C2H2-type zinc finger
94-121 Zinc-finger double domain
108-132 C2H2-type zinc finger
127-150 Zinc-finger double domain
138-162 C2H2-type zinc finger
138-162 Zinc finger, C2H2 type
154-180 Zinc-finger double domain
168-192 C2H2-type zinc finger
168-192 Zinc finger, C2H2 type
184-209 Zinc-finger double domain
198-221 C2H2-type zinc finger
198-221 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MAATRVTAKSQQSGEKAFRCEYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFA 60
61 TGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFT 120
121 TSNIRKVHVRTHTGERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFT 180
181 EYSSLYKHHVVHTHSKPYNCNHCGKTYKQISTLAMHKRTAHNDTEPIEEEQEAFFEPPPG 240
241 QGEDVLK
Interface Residues: 31, 33, 34, 37, 60, 61, 62, 63, 64, 67, 77, 90, 91, 92, 93, 94, 96, 97, 99, 100, 103, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 130, 131, 151, 152, 153, 154, 156, 157, 181, 182, 183, 184, 185, 186, 187, 188, 209, 210, 211, 212, 215, 218
3D-footprint Homologues: 8ssq_A, 5v3j_F, 8ssu_A, 6u9q_A, 7w1m_H, 7ysf_A, 1tf3_A, 1tf6_A, 1ubd_C, 6vdd_A, 7y3l_A, 7n5w_A, 8cuc_F, 2gli_A, 8gn3_A, 2kmk_A, 8h9h_G, 7y3m_I, 2jpa_A, 7txc_E, 6e94_A, 2lt7_A, 8gh6_A
Binding Motifs: ZNF143_DBD ywCCCAyAATGCAyyG
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.