Transcription Factor
| Accessions: | ZNF143_DBD (HumanTF 1.0) |
| Names: | Fragment, Q9H176_HUMAN, ZNF143, ZNF143 protein |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Uniprot: | Q9H176 |
| Notes: | Ensembl ID: ENSG00000166478; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Megaman |
| Length: | 247 |
| Pfam Domains: | 18-42 Zinc finger, C2H2 type 18-42 C2H2-type zinc finger 34-61 Zinc-finger double domain 48-72 C2H2-type zinc finger 48-72 Zinc finger, C2H2 type 65-91 Zinc-finger double domain 78-102 C2H2-type zinc finger 78-102 Zinc finger, C2H2 type 94-121 Zinc-finger double domain 108-132 C2H2-type zinc finger 127-150 Zinc-finger double domain 138-162 C2H2-type zinc finger 138-162 Zinc finger, C2H2 type 154-180 Zinc-finger double domain 168-192 C2H2-type zinc finger 168-192 Zinc finger, C2H2 type 184-209 Zinc-finger double domain 198-221 Zinc finger, C2H2 type 198-221 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MAATRVTAKSQQSGEKAFRCEYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFA 60 61 TGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFT 120 121 TSNIRKVHVRTHTGERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFT 180 181 EYSSLYKHHVVHTHSKPYNCNHCGKTYKQISTLAMHKRTAHNDTEPIEEEQEAFFEPPPG 240 241 QGEDVLK |
| Interface Residues: | 31, 33, 34, 37, 60, 61, 62, 63, 64, 67, 68, 77, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 103, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 130, 131, 151, 152, 153, 154, 156, 157, 181, 182, 183, 184, 185, 186, 187, 188, 209, 210, 211, 212, 213, 215, 218 |
| 3D-footprint Homologues: | 7w1m_H, 5v3j_F, 8ssq_A, 6u9q_A, 8ssu_A, 7ysf_A, 3uk3_C, 1tf3_A, 5und_A, 1mey_C, 6ml4_A, 6blw_A, 2i13_A, 1g2f_F, 1tf6_A, 5ei9_F, 4m9v_C, 1ubd_C, 6vdd_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 6wmi_A, 2kmk_A, 2gli_A, 1f2i_J, 5kkq_D, 4x9j_A, 2wbs_A, 8gn3_A, 1llm_D, 8h9h_G, 7eyi_G, 7y3m_I, 6a57_A, 5yel_A, 2jpa_A, 5kl3_A, 7txc_E, 6e94_A, 5k5i_A, 5yj3_D, 2lt7_A, 8gh6_A |
| Binding Motifs: | ZNF143_DBD ywCCCAyAATGCAyyG |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.