Transcription Factor

Accessions: SNAI2_MOUSE (HOCOMOCO 10)
Names: Neural crest transcription factor Slug, Protein snail homolog 2, SNAI2_MOUSE, Zinc finger protein SNAI2
Organisms: Mus musculus
Libraries: HOCOMOCO 10 1
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
Uniprot: P97469
Length: 269
Pfam Domains: 129-153 C2H2-type zinc finger
129-151 Zinc finger, C2H2 type
129-150 C2H2-type zinc finger
160-182 C2H2-type zinc finger
160-182 Zinc finger, C2H2 type
160-182 C2H2-type zinc finger
174-197 Zinc-finger double domain
187-208 Zinc finger, C2H2 type
187-208 C2H2-type zinc finger
188-204 C2H2-type zinc finger
201-224 Zinc-finger double domain
214-236 C2H2-type zinc finger
214-234 Zinc-finger of C2H2 type
214-236 C2H2-type zinc finger
214-236 Zinc finger, C2H2 type
228-253 Zinc-finger double domain
242-263 Zinc finger, C2H2 type
242-262 C2H2-type zinc finger
242-257 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYPIPVIPKPEILTSGAYSPITVWT 60
61 SSAAPLHSPLPSGLSPLTGYSSSLGRVSPPPSSDTSSKDHSGSESPISDEEERLQPKLSD 120
121 PHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIR 180
181 THTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVK 240
241 KYQCKNCSKTFSRMSLLHKHEESGCCVAH
Interface Residues: 139, 140, 142, 143, 146, 150, 170, 171, 172, 173, 174, 176, 177, 179, 180, 183, 196, 197, 198, 199, 200, 202, 203, 204, 224, 225, 226, 227, 228, 229, 230, 231, 232, 235, 252, 253, 254, 255, 256, 258, 259
3D-footprint Homologues: 7w1m_H, 5kkq_D, 5yel_A, 6wmi_A, 8ssq_A, 8ssu_A, 2i13_A, 1ubd_C, 7n5w_A, 6jnm_A, 6ml4_A, 4x9j_A, 6blw_A, 5ei9_F, 5kl3_A, 5und_A, 1g2f_F, 8h9h_G, 7eyi_G, 6e94_A, 7ysf_A, 2gli_A, 6a57_A, 2jpa_A, 7y3l_A, 3uk3_C, 1tf3_A, 8cuc_F, 1tf6_A, 5v3j_F, 1llm_D, 2wbs_A, 6u9q_A, 1mey_C, 7txc_E, 1f2i_J, 5k5i_A, 2kmk_A, 4m9v_C, 7y3m_I, 2lt7_A, 8gn3_A, 2drp_D, 5yj3_D, 5k5l_F
Binding Motifs: SNAI2_MOUSE.H10MO.C|M01340 yCAGGTG
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.