Transcription Factor

Accessions: Q8L467 (JASPAR 2024), T18660 (AthalianaCistrome v4_May2016)
Names: AtbHLH104, Basic helix-loop-helix protein 104, BH104_ARATH, bHLH 104, bHLH transcription factor bHLH104, Transcription factor bHLH104, Transcription factor EN 136, AT4G14410, bHLH104, T18660;
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2024 1, AthalianaCistrome v4_May2016 2
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Uniprot: Q8L467
Notes: ecotype:Col-0, experiment type: DAP-seq, family:bHLH
Length: 283
Pfam Domains: 135-181 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MYPSLDDDFVSDLFCFDQSNGAELDDYTQFGVNLQTDQEDTFPDFVSYGVNLQQEPDEVF 60
61 SIGASQLDLSSYNGVLSLEPEQVGQQDCEVVQEEEVEINSGSSGGAVKEEQEHLDDDCSR 120
121 KRARTGSCSRGGGTKACRERLRREKLNERFMDLSSVLEPGRTPKTDKPAILDDAIRILNQ 180
181 LRDEALKLEETNQKLLEEIKSLKAEKNELREEKLVLKADKEKTEQQLKSMTAPSSGFIPH 240
241 IPAAFNHNKMAVYPSYGYMPMWHYMPQSVRDTSRDQELRPPAA
Interface Residues: 138, 139, 140, 142, 143
3D-footprint Homologues: 8osb_B, 6od3_F, 7z5k_B, 2ql2_A, 5gnj_I, 1an4_A, 8ia3_B
Binding Motifs: MA0960.1 GGCACGTGCC
M0175 GvCACGTGbcwrcmhskgsm
Publications: Fernández-Calvo P, Chini A, Fernández-Barbero G, Chico J.M, Gimenez-Ibanez S, Geerinck J, Eeckhout D, Schweizer F, Godoy M, Franco-Zorrilla J.M, Pauwels L, Witters E, Puga M.I, Paz-Ares J, Goossens A, Reymond P, De Jaeger G, Solano R. The Arabidopsis bHLH transcription factors MYC3 and MYC4 are targets of JAZ repressors and act additively with MYC2 in the activation of jasmonate responses. The Plant cell 23:701-15 (2011). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.