Transcription Factor
| Accessions: | HEY2_DBD (HumanTF 1.0), HEY2 (HT-SELEX2 May2017) |
| Names: | A8K1M8_HUMAN, cDNA FLJ75594, highly similar to Homo sapiens hairy/enhancer-of-split related with YRPW motif 2, HEY2, ENSG00000135547 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | A8K1M8 |
| Notes: | Ensembl ID: ENSG00000135547; DNA-binding domain sequence; TF family: bHLH; Clone source: MGC, TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 128 |
| Pfam Domains: | 25-77 Helix-loop-helix DNA-binding domain 96-128 Hairy Orange |
| Sequence: (in bold interface residues) | 1 GQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKL 60 61 EKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSD 120 121 PLRVRLVS |
| Interface Residues: | 23, 25, 26, 27, 29, 30, 33, 34, 60, 62 |
| 3D-footprint Homologues: | 7z5k_B, 1an4_A, 7f2f_B, 4h10_B, 7ssa_L, 8osl_O, 6g1l_A, 5sy7_B, 7d8t_A, 5eyo_A, 1am9_A, 4h10_A, 7xi3_A, 5v0l_A, 5nj8_D, 2ql2_D, 4zpk_A, 1a0a_B, 2ypa_A, 8osl_P, 5nj8_C, 7xi3_B, 5v0l_B |
| Binding Motifs: | HEY2_DBD grCACGTGcC HEY2_2 ggCRCGYGyc HEY2_4 ggCACGTGyc HEY2_methyl_1 sgcrCGyGys HEY2_methyl_3 gsCRCGyGys |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.