Transcription Factor

Accessions: HEY2_DBD (HumanTF 1.0), HEY2 (HT-SELEX2 May2017)
Names: A8K1M8_HUMAN, cDNA FLJ75594, highly similar to Homo sapiens hairy/enhancer-of-split related with YRPW motif 2, HEY2, ENSG00000135547
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: A8K1M8
Notes: Ensembl ID: ENSG00000135547; DNA-binding domain sequence; TF family: bHLH; Clone source: MGC, TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 128
Pfam Domains: 25-77 Helix-loop-helix DNA-binding domain
96-128 Hairy Orange
Sequence:
(in bold interface residues)
1 GQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKL 60
61 EKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSD 120
121 PLRVRLVS
Interface Residues: 18, 23, 25, 26, 27, 29, 30, 33, 34, 60, 62
3D-footprint Homologues: 8osb_B, 7z5k_B, 1an4_A, 8osl_O, 7ssa_L, 6g1l_A, 5sy7_B, 8ia3_B, 7d8t_A, 7f2f_B, 4h10_B, 8hov_A, 5eyo_A, 7xi3_A, 1am9_A, 4h10_A, 5nj8_D, 2ql2_D, 4zpk_A, 1a0a_B, 8osl_P, 2ypa_A, 5v0l_A, 7xi3_B, 5nj8_C, 5v0l_B
Binding Motifs: HEY2_DBD grCACGTGcC
HEY2_2 ggCRCGYGyc
HEY2_4 ggCACGTGyc
HEY2_methyl_1 sgcrCGyGys
HEY2_methyl_3 gsCRCGyGys
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.