Transcription Factor

Accessions: O08713 (JASPAR 2024)
Names: Fragment, Homeobox protein, O08713_MOUSE
Organisms: Mus musculus
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: O08713
Length: 60
Pfam Domains: 2-58 Homeobox domain
Sequence:
(in bold interface residues)
1 PRRARTAFTYEQLVALENKFKATRYLSVCERLNLGLSLSLTETQVKIWFQNRRTKWKKQN 60
Interface Residues: 2, 3, 4, 5, 43, 44, 46, 47, 50, 51, 53, 54, 55, 58
3D-footprint Homologues: 1puf_A, 3d1n_M, 8ejp_B, 6a8r_A, 1fjl_B, 5zfz_A, 1ig7_A, 3cmy_A, 8pmf_A, 1jgg_B, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 6m3d_C, 2ld5_A, 4cyc_A, 2r5y_A, 8ik5_C, 7psx_B, 5hod_A, 2hos_A, 9b8u_A, 8osb_E, 7q3o_C, 1au7_A, 5jlw_D, 8eml_B, 6es3_K, 4xrs_G, 3a01_E, 1b72_A, 3rkq_B, 5flv_I, 2hdd_A, 5zjt_E, 1e3o_C, 2xsd_C, 8pi8_B, 1le8_A, 7xrc_C, 1mnm_C, 4qtr_D, 1puf_B, 1k61_B, 1o4x_A, 8g87_X, 1le8_B, 8bx1_A, 1du0_A
Binding Motifs: PH0109.1 wgmrcyAATTrgyGsgr
Publications: Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.