Transcription Factor

						

			
Accessions: 2jp9_A (3D-footprint 20231221), 2jpa_A (3D-footprint 20231221)

			
Names: Wilms tumor 1, Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19544
Length: 119
Pfam Domains:      9-31 C2H2-type zinc finger
    23-50 Zinc-finger double domain
    37-61 C2H2-type zinc finger
    37-61 Zinc finger, C2H2 type
    54-78 Zinc-finger double domain
    67-89 C2H2-type zinc finger
    67-89 Zinc finger, C2H2 type
    67-87 Zinc-finger of C2H2 type
   81-107 Zinc-finger double domain
   95-115 C2H2-type zinc finger
   95-119 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRR   60
  61 HTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Interface Residues: 19, 20, 21, 22, 23, 25, 26, 28, 29, 32, 49, 50, 51, 52, 53, 55, 56, 57, 60, 77, 78, 79, 80, 81, 82, 83, 84, 85, 107, 108, 109, 110, 111, 113, 114
3D-footprint Homologues: 6jnm_A, 3uk3_C, 7n5w_A, 5ei9_F, 8ssq_A, 7w1m_H, 5und_A, 8ssu_A, 2kmk_A, 6ml4_A, 5v3j_F, 6blw_A, 5kkq_D, 6u9q_A, 2i13_A, 7eyi_G, 2gli_A, 8h9h_G, 7ysf_A, 6wmi_A, 2lt7_A, 7y3m_I, 1tf6_A, 6e94_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 1tf3_A, 2wbs_A, 1mey_C, 2drp_D, 1f2i_J, 5k5i_A, 1g2f_F, 5yel_A, 4x9j_A, 7txc_E, 5kl3_A, 4m9v_C, 6a57_A, 8gn3_A, 5yj3_D, 1llm_D
Binding Motifs: 2jp9_A GCGGGGGCGTnTgC
2jpa_A GCGGGGGCGTnTG
Binding Sites: 2jp9_B
2jp9_C
2jpa_B
2jpa_C
			
Publications: Stoll R, Lee B.M, Debler E.W, Laity J.H, Wilson I.A, Dyson H.J, Wright P.E. Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA. Journal of molecular biology 372:1227-45 (2007). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.