Transcription Factor
| Accessions: | 2jp9_A (3D-footprint 20250804), 2jpa_A (3D-footprint 20250804) |
| Names: | Wilms tumor 1, Wilms tumor protein, WT1_HUMAN, WT33 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P19544 |
| Length: | 119 |
| Pfam Domains: | 9-31 C2H2-type zinc finger 23-50 Zinc-finger double domain 37-61 Zinc finger, C2H2 type 37-61 C2H2-type zinc finger 54-78 Zinc-finger double domain 67-87 Zinc-finger of C2H2 type 67-89 Zinc finger, C2H2 type 67-89 C2H2-type zinc finger 81-107 Zinc-finger double domain 95-119 Zinc finger, C2H2 type 95-115 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRR 60 61 HTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH |
| Interface Residues: | 19, 20, 21, 22, 23, 25, 26, 28, 29, 32, 49, 50, 51, 52, 53, 55, 56, 57, 60, 77, 78, 79, 80, 81, 82, 83, 84, 85, 107, 108, 109, 110, 111, 113, 114 |
| 3D-footprint Homologues: | 3uk3_C, 7n5w_A, 6jnm_A, 5v3j_F, 8ssq_A, 7w1m_H, 6blw_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 5ei9_F, 6ml4_A, 2gli_A, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 1tf6_A, 7ysf_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 1tf3_A, 5k5i_A, 5yel_A, 2drp_D, 4x9j_A, 1f2i_J, 5kl3_A, 2wbs_A, 7txc_E, 1g2f_F, 4m9v_C, 6a57_A, 8gn3_A, 1llm_D, 5yj3_D |
| Binding Motifs: | 2jp9_A GCGGGGGCGTnTgC 2jpa_A GCGGGGGCGTnTG |
| Binding Sites: | 2jp9_B 2jp9_C 2jpa_B 2jpa_C |
| Publications: | Stoll R, Lee B.M, Debler E.W, Laity J.H, Wilson I.A, Dyson H.J, Wright P.E. Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA. Journal of molecular biology 372:1227-45 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.