Transcription Factor

Accessions: 2jp9_A (3D-footprint 20250804), 2jpa_A (3D-footprint 20250804)
Names: Wilms tumor 1, Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19544
Length: 119
Pfam Domains: 9-31 C2H2-type zinc finger
23-50 Zinc-finger double domain
37-61 Zinc finger, C2H2 type
37-61 C2H2-type zinc finger
54-78 Zinc-finger double domain
67-87 Zinc-finger of C2H2 type
67-89 Zinc finger, C2H2 type
67-89 C2H2-type zinc finger
81-107 Zinc-finger double domain
95-119 Zinc finger, C2H2 type
95-115 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRR 60
61 HTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Interface Residues: 19, 20, 21, 22, 23, 25, 26, 28, 29, 32, 49, 50, 51, 52, 53, 55, 56, 57, 60, 77, 78, 79, 80, 81, 82, 83, 84, 85, 107, 108, 109, 110, 111, 113, 114
3D-footprint Homologues: 3uk3_C, 7n5w_A, 6jnm_A, 5v3j_F, 8ssq_A, 7w1m_H, 6blw_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 5ei9_F, 6ml4_A, 2gli_A, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 1tf6_A, 7ysf_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 1tf3_A, 5k5i_A, 5yel_A, 2drp_D, 4x9j_A, 1f2i_J, 5kl3_A, 2wbs_A, 7txc_E, 1g2f_F, 4m9v_C, 6a57_A, 8gn3_A, 1llm_D, 5yj3_D
Binding Motifs: 2jp9_A GCGGGGGCGTnTgC
2jpa_A GCGGGGGCGTnTG
Binding Sites: 2jp9_B
2jp9_C
2jpa_B
2jpa_C
Publications: Stoll R, Lee B.M, Debler E.W, Laity J.H, Wilson I.A, Dyson H.J, Wright P.E. Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA. Journal of molecular biology 372:1227-45 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.