Transcription Factor
Accessions: | 4aa6_B (3D-footprint 20231221) |
Names: | ER, ER-alpha, ESR1_HUMAN, Estradiol receptor, ESTROGEN RECEPTOR, Nuclear receptor subfamily 3 group A member 1 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P03372 |
Length: | 70 |
Pfam Domains: | 3-70 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHDYMCPATNQCTIDKNRRKSCQACRL 60 61 RKCYEVGMMK |
Interface Residues: | 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 53 |
3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B |
Binding Motifs: | 4aa6_AB GGTCAnnnTGACc |
Binding Sites: | 4aa6_C 4aa6_D |
Publications: | Schwabe J.W, Chapman L, Rhodes D. The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation. Structure (London, England : 1993) 3:201-13 (1995). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.