Transcription Factor
| Accessions: | ZNF524 (HT-SELEX2 May2017), Q96C55 (JASPAR 2024) |
| Names: | ENSG00000171443, ZNF524, ZN524_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3b0 |
| Length: | 264 |
| Pfam Domains: | 113-137 C2H2-type zinc finger 116-136 C2H2-type zinc finger 128-153 Zinc-finger double domain 141-154 C2H2-type zinc finger 142-164 Zinc finger, C2H2 type 142-162 C2H2-type zinc finger 143-162 Zinc-finger of C2H2 type 156-179 Zinc-finger double domain 170-192 Zinc finger, C2H2 type 170-192 C2H2-type zinc finger 187-208 Zinc-finger double domain 198-221 Zinc finger, C2H2 type 198-221 C2H2-type zinc finger 198-216 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MDTPSPDPLPSPLPGEEEKPLALSPPVPRGRRGRRPGGATSSNRTLKASLPRKRGRPPKS 60 61 GQEPPLVQVQGVTAPVGSSGGSDLLLIDDQGVPYTVSEGSAAGPEGSGPRKAPHFCPVCL 120 121 RAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHLRRHCNIHAGLRPFRCPLCPRRFR 180 181 EAGELAHHHRVHSGERPYQCPICRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPW 240 241 DEEGIPATAGAEEEEETEGKGEPA |
| Interface Residues: | 125, 126, 127, 128, 130, 131, 133, 134, 137, 152, 153, 154, 155, 156, 158, 159, 160, 180, 181, 182, 183, 184, 185, 186, 187, 188, 190, 194, 195, 208, 209, 210, 211, 212, 213, 214, 215, 219 |
| 3D-footprint Homologues: | 5yel_A, 5ei9_F, 8ssq_A, 7w1m_H, 2drp_D, 8ssu_A, 6ml4_A, 5v3j_F, 2gli_A, 8gn3_A, 6blw_A, 5kkq_D, 7eyi_G, 2i13_A, 6e94_A, 7ysf_A, 6wmi_A, 2jpa_A, 1ubd_C, 1tf3_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 6u9q_A, 4x9j_A, 1mey_C, 5kl3_A, 5und_A, 1g2f_F, 2kmk_A, 1tf6_A, 1llm_D, 8h9h_G, 4m9v_C, 2lt7_A, 7y3m_I, 6a57_A, 3uk3_C, 7txc_E, 2wbs_A, 1f2i_J, 5yj3_D, 5k5i_A, 1yuj_A |
| Binding Motifs: | UN0200.1 / ZNF524_2 mcTCGrACCCgk ZNF524_methyl_1 mCTCGAACCCgy MA2096.1 cTCGrACCC |
| Publications: | Schmitges FW, Radovani E, Najafabadi HS, Barazandeh M, Campitelli LF, Yin Y, Jolma A, Zhong G, Guo H, Kanagalingam T, Dai WF, Taipale J, Emili A, Greenblatt JF, Hughes TR. Multiparameter functional diversity of human C2H2 zinc finger proteins. Genome Res 26:1742-1752 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.