Transcription Factor

Accessions: 1apl_D (3D-footprint 20260701), 1k61_D (3D-footprint 20260701)
Names: Alpha-2 repressor, MAT-ALPHA2 HOMEODOMAIN, MATalpha2 protein, Mating-type protein ALPHA2, MTAL2_YEAST, Mating-type protein alpha-2
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CY08
Length: 58
Pfam Domains: 4-57 Homeobox domain
16-54 Homeobox KN domain
Sequence:
(in bold interface residues)
1 RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT
Interface Residues: 1, 3, 4, 43, 44, 46, 47, 50, 51, 54, 55
3D-footprint Homologues: 1mnm_C, 1k61_B, 1le8_B, 4j19_B, 2ld5_A, 5jlw_D, 7q3o_C, 1e3o_C, 7xrc_C, 1ig7_A, 2xsd_C, 1du0_A, 8eml_B, 6es3_K, 3rkq_B, 5flv_I, 3a01_E, 1puf_B, 8g87_X, 6fqp_B, 3cmy_A, 1zq3_P, 8pmf_A, 6fqq_E, 4xrm_B, 2lkx_A, 1b72_A, 8ejp_B, 5zjt_E, 3d1n_M, 2hdd_A, 1jgg_B, 9b8u_A, 7psx_B, 4xrs_G, 1nk2_P, 2hos_A
Binding Motifs: 1apl_CD TTGTAnTTnATnTACA
1apl_D TGTanTt
1k61_ABCD GCTTGTAAAnGAATTACA
Binding Sites: 1apl_A / 1k61_E
1apl_B / 1k61_F
Publications: Wolberger C., Vershon A. K., Liu B., Johnson A. D., Pabo C. O. Crystal structure of a MATalpha2 homeodomain-operator complex suggests a general model for homeodomain-DNA interactions. Cell 67:517-528 (1991). [Pubmed]

Aishima J, Gitti R.K, Noah J.E, Gan H.H, Schlick T, Wolberger C. A Hoogsteen base pair embedded in undistorted B-DNA. Nucleic acids research 30:5244-52 (2002). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.