Transcription Factor
| Accessions: | 1apl_D (3D-footprint 20260701), 1k61_D (3D-footprint 20260701) |
| Names: | Alpha-2 repressor, MAT-ALPHA2 HOMEODOMAIN, MATalpha2 protein, Mating-type protein ALPHA2, MTAL2_YEAST, Mating-type protein alpha-2 |
| Organisms: | Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0CY08 |
| Length: | 58 |
| Pfam Domains: | 4-57 Homeobox domain 16-54 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT |
| Interface Residues: | 1, 3, 4, 43, 44, 46, 47, 50, 51, 54, 55 |
| 3D-footprint Homologues: | 1mnm_C, 1k61_B, 1le8_B, 4j19_B, 2ld5_A, 5jlw_D, 7q3o_C, 1e3o_C, 7xrc_C, 1ig7_A, 2xsd_C, 1du0_A, 8eml_B, 6es3_K, 3rkq_B, 5flv_I, 3a01_E, 1puf_B, 8g87_X, 6fqp_B, 3cmy_A, 1zq3_P, 8pmf_A, 6fqq_E, 4xrm_B, 2lkx_A, 1b72_A, 8ejp_B, 5zjt_E, 3d1n_M, 2hdd_A, 1jgg_B, 9b8u_A, 7psx_B, 4xrs_G, 1nk2_P, 2hos_A |
| Binding Motifs: | 1apl_CD TTGTAnTTnATnTACA 1apl_D TGTanTt 1k61_ABCD GCTTGTAAAnGAATTACA |
| Binding Sites: | 1apl_A / 1k61_E 1apl_B / 1k61_F |
| Publications: | Wolberger C., Vershon A. K., Liu B., Johnson A. D., Pabo C. O. Crystal structure of a MATalpha2 homeodomain-operator complex suggests a general model for homeodomain-DNA interactions. Cell 67:517-528 (1991). [Pubmed] Aishima J, Gitti R.K, Noah J.E, Gan H.H, Schlick T, Wolberger C. A Hoogsteen base pair embedded in undistorted B-DNA. Nucleic acids research 30:5244-52 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.