Transcription Factor
| Accessions: | ZNF660 (HT-SELEX2 May2017), Q6AZW8 (JASPAR 2024) |
| Names: | ENSG00000144792, ZNF660, ZN660_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 331 |
| Pfam Domains: | 50-72 Zinc finger, C2H2 type 50-72 C2H2-type zinc finger 50-68 C2H2-type zinc finger 64-89 Zinc-finger double domain 77-98 C2H2-type zinc finger 78-100 Zinc finger, C2H2 type 78-100 C2H2-type zinc finger 92-116 Zinc-finger double domain 105-117 C2H2-type zinc finger 106-128 Zinc finger, C2H2 type 106-126 C2H2-type zinc finger 120-145 Zinc-finger double domain 133-156 C2H2-type zinc finger 134-156 Zinc finger, C2H2 type 134-156 C2H2-type zinc finger 150-173 Zinc-finger double domain 162-184 C2H2-type zinc finger 162-186 C2H2-type zinc finger 162-184 Zinc finger, C2H2 type 176-199 Zinc-finger double domain 189-198 C2H2-type zinc finger 208-227 Zinc-finger double domain 217-242 C2H2-type zinc finger 218-240 C2H2-type zinc finger 218-240 Zinc finger, C2H2 type 233-257 Zinc-finger double domain 245-268 C2H2-type zinc finger 246-268 Zinc finger, C2H2 type 246-268 C2H2-type zinc finger 260-284 Zinc-finger double domain 273-284 C2H2-type zinc finger 274-296 Zinc finger, C2H2 type 274-296 C2H2-type zinc finger 292-312 Zinc-finger double domain 301-325 C2H2-type zinc finger 302-324 Zinc finger, C2H2 type 302-325 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MRRKTRNFKHKTVKDNKVLTEGSDQESEKDNSQCCDPATNERVQAEKRQYVCTECGKAFS 60 61 QSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSECGKSFSGKSH 120 121 LIRHQGIHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKPYSCIECGKAFSRSSNLTQH 180 181 QRMHRGKKVYKCKECGKTCGSNTKIMDHQRIHTGEKPYECDECGKTFILRKTLNEHQRLH 240 241 RREKPYKCNECGKAFTSNRNLVDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEK 300 301 PYKCSECGKAYRYSSQLIQHQRKHNEEKETS |
| Interface Residues: | 60, 61, 63, 64, 67, 71, 78, 88, 89, 90, 91, 92, 94, 95, 97, 98, 99, 101, 116, 117, 118, 119, 120, 122, 123, 127, 144, 145, 146, 147, 148, 150, 151, 173, 174, 175, 176, 179, 200, 201, 202, 203, 204, 207, 210, 229, 230, 231, 232, 235, 241, 255, 256, 257, 258, 259, 260, 263, 264, 267, 284, 285, 286, 287, 288, 289, 290, 291, 292, 312, 313, 314, 315, 316, 318, 319 |
| 3D-footprint Homologues: | 1tf3_A, 7w1m_H, 8cuc_F, 7y3l_A, 1ubd_C, 6u9q_A, 1mey_C, 1f2i_J, 2gli_A, 1g2f_F, 1tf6_A, 5kkq_D, 7y3m_I, 6e94_A, 2kmk_A, 5ei9_F, 8ssq_A, 8ssu_A, 6ml4_A, 2i13_A, 8gn3_A, 7ysf_A, 2jpa_A, 5kl3_A, 5yj3_D, 5k5i_A, 5v3j_F, 4x9j_A, 6blw_A, 8h9h_G, 2lt7_A, 2wbs_A, 2drp_D, 1llm_D, 5und_A, 5yel_A, 7n5w_A, 6wmi_A, 7eyi_G, 3uk3_C, 6jnm_A, 7txc_E, 4m9v_C, 6a57_A, 5k5l_F |
| Binding Motifs: | UN0211.1 / ZNF660_2 ayTGATkvCCCAyCCTay ZNF660_methyl_1 ayTGATkmCCCAyCCTay UN0211.2 yTGATkvCCCAyCCTa |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.