Transcription Factor
| Accessions: | P17019 (JASPAR 2024) |
| Names: | Zinc finger protein 15, Zinc finger protein 15-like 1, Zinc finger protein 708, Zinc finger protein KOX8, ZN708_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P17019 |
| Length: | 499 |
| Pfam Domains: | 92-113 Zinc-finger double domain 104-126 Zinc finger, C2H2 type 104-122 C2H2-type zinc finger 119-142 Zinc-finger double domain 131-151 C2H2-type zinc finger 132-154 Zinc finger, C2H2 type 132-154 C2H2-type zinc finger 146-170 Zinc-finger double domain 159-179 C2H2-type zinc finger 160-182 Zinc finger, C2H2 type 160-182 C2H2-type zinc finger 175-198 Zinc-finger double domain 187-210 C2H2-type zinc finger 188-210 Zinc finger, C2H2 type 188-210 C2H2-type zinc finger 202-227 Zinc-finger double domain 215-236 C2H2-type zinc finger 216-238 Zinc finger, C2H2 type 216-238 C2H2-type zinc finger 230-254 Zinc-finger double domain 243-264 C2H2-type zinc finger 244-266 C2H2-type zinc finger 244-266 Zinc finger, C2H2 type 258-282 Zinc-finger double domain 271-291 C2H2-type zinc finger 272-294 C2H2-type zinc finger 272-294 Zinc finger, C2H2 type 287-310 Zinc-finger double domain 299-319 C2H2-type zinc finger 300-319 C2H2-type zinc finger 300-322 Zinc finger, C2H2 type 314-338 Zinc-finger double domain 327-347 C2H2-type zinc finger 328-350 Zinc finger, C2H2 type 328-347 C2H2-type zinc finger 343-366 Zinc-finger double domain 355-375 C2H2-type zinc finger 371-395 Zinc-finger double domain 383-404 C2H2-type zinc finger 384-406 Zinc finger, C2H2 type 384-406 C2H2-type zinc finger 398-421 Zinc-finger double domain 411-425 C2H2-type zinc finger 412-434 Zinc finger, C2H2 type 412-434 C2H2-type zinc finger 426-450 Zinc-finger double domain 439-459 C2H2-type zinc finger 440-462 Zinc finger, C2H2 type 440-462 C2H2-type zinc finger 455-478 Zinc-finger double domain 467-488 C2H2-type zinc finger 468-490 Zinc finger, C2H2 type 468-490 C2H2-type zinc finger 482-499 Zinc-finger double domain |
| Sequence: (in bold interface residues) | 1 MKRHEMAAKPPAMCSHFAKDLRPEQYIKNSFQQVILRRYGKCGYQKGCKSVDEHKLHKGG 60 61 HKGLNRCVTTTQSKIVQCDKYVKVFHKYSNAKRHKIRHTGKNPFKCKECGKSFCMLSQLT 120 121 QHEIIHTGEKPYKCEECGKAFKKSSNLTNHKIIHTGEKPYKCEECGKAFNQSSTLTRHKI 180 181 IHTGEKLYKCEECGKAFNRSSNLTKHKIVHTGEKPYKCEECGKAFKQSSNLTNHKKIHTG 240 241 EKPYKCGECGKAFTLSSHLTTHKRIHTGEKPYKCEECGKAFSVFSTLTKHKIIHTEEKPY 300 301 KCEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLTYHKVIHTGKKPYKCEE 360 361 CGKAFSIFSILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECGKS 420 421 FILSSHLTTHKIIHTGEKPYKCKECGKAFNQSSTLMKHKIIHTGEKPYKCEECGKAFNQS 480 481 PNLTKHKRIHTKEKPYKCK |
| Interface Residues: | 95, 117, 118, 120, 121, 142, 143, 145, 146, 149, 153, 170, 171, 172, 173, 174, 177, 198, 199, 200, 201, 202, 204, 205, 207, 226, 227, 229, 230, 233, 255, 256, 257, 258, 260, 261, 263, 264, 265, 267, 283, 284, 285, 286, 289, 311, 312, 313, 314, 316, 317, 338, 339, 340, 341, 342, 345, 367, 368, 369, 370, 373, 396, 397, 398, 401, 407, 412, 421, 423, 424, 425, 426, 429, 433, 450, 451, 452, 453, 454, 457, 478, 479, 480, 481, 482, 485 |
| 3D-footprint Homologues: | 2lt7_A, 1tf3_A, 8ssu_A, 1tf6_A, 7n5w_A, 8gn3_A, 7txc_E, 8h9h_G, 1ubd_C, 7w1m_H, 2drp_D, 6e94_A, 7y3l_A, 8cuc_F, 2gli_A, 6u9q_A, 5v3j_F, 8ssq_A, 2jpa_A, 7ysf_A, 2kmk_A, 7y3m_I |
| Binding Motifs: | MA1730.1 / UN0339.1 ccrGCTGTrCCTccy MA1730.2 GCTGTrCCT |
| Binding Sites: | MA1730.1.1 / UN0339.1.1 MA1730.1.10 / UN0339.1.10 MA1730.1.11 / UN0339.1.11 MA1730.1.12 / UN0339.1.12 UN0339.1.13 MA1730.1.13 / UN0339.1.14 MA1730.1.14 / UN0339.1.15 MA1730.1.15 / UN0339.1.16 UN0339.1.17 MA1730.1.17 / UN0339.1.18 MA1730.1.18 / UN0339.1.19 MA1730.1.2 / UN0339.1.2 MA1730.1.19 / UN0339.1.20 MA1730.1.3 / UN0339.1.3 MA1730.1.4 / UN0339.1.4 MA1730.1.6 / UN0339.1.5 MA1730.1.7 / UN0339.1.6 MA1730.1.8 / UN0339.1.7 MA1730.1.9 / UN0339.1.8 UN0339.1.9 MA1730.1.16 MA1730.1.20 MA1730.1.5 MA1730.2.1 / MA1730.2.3 MA1730.2.10 / MA1730.2.19 / MA1730.2.20 / MA1730.2.9 MA1730.2.11 / MA1730.2.14 / MA1730.2.17 / MA1730.2.7 MA1730.2.12 / MA1730.2.6 MA1730.2.13 MA1730.2.15 MA1730.2.16 MA1730.2.18 MA1730.2.2 MA1730.2.4 MA1730.2.5 MA1730.2.8 |
| Publications: | Imbeault M, Helleboid PY, Trono D. KRAB zinc-finger proteins contribute to the evolution of gene regulatory networks. Nature 543:550-554 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.