Transcription Factor
| Accessions: | ZSCAN29 (HT-SELEX2 May2017) |
| Names: | ENSG00000140265, ZSCAN29 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3b0, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3b0 |
| Length: | 194 |
| Pfam Domains: | 7-31 Zinc-finger double domain 19-40 C2H2-type zinc finger 20-42 Zinc finger, C2H2 type 20-42 C2H2-type zinc finger 35-57 Zinc-finger double domain 47-68 C2H2-type zinc finger 48-70 Zinc finger, C2H2 type 48-70 C2H2-type zinc finger 65-86 Zinc-finger double domain 76-98 C2H2-type zinc finger 76-98 Zinc finger, C2H2 type 76-98 C2H2-type zinc finger 91-115 Zinc-finger double domain 104-126 C2H2-type zinc finger 104-126 Zinc finger, C2H2 type 104-124 C2H2-type zinc finger 119-142 Zinc-finger double domain 131-154 C2H2-type zinc finger 132-154 C2H2-type zinc finger 132-154 Zinc finger, C2H2 type 146-170 Zinc-finger double domain 160-178 C2H2-type zinc finger 160-182 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 SFGPNSLLMHQVSHQVENPYKCADCGKSFSRSARLIRHRRIHTGEKPYKCLDCGKSFRDS 60 61 SNFITHRRIHTGEKPYQCGECGKCFNQSSSLIIHQRTHTGEKPYQCEECGKSFNNSSHFS 120 121 AHRRIHTGERPHVCPDCGKSFSKSSDLRAHHRTHTGEKPYGCHDCGKCFSKSSALNKHGE 180 181 IHAREKLLTQSAPK |
| Interface Residues: | 5, 20, 31, 32, 33, 34, 37, 41, 58, 59, 60, 61, 62, 64, 65, 66, 67, 68, 71, 86, 87, 88, 89, 90, 91, 93, 94, 114, 115, 116, 117, 118, 120, 121, 124, 142, 143, 144, 145, 146, 147, 148, 149, 170, 171, 172, 173, 174, 177 |
| 3D-footprint Homologues: | 5v3j_F, 2kmk_A, 5ei9_F, 1f2i_J, 8ssq_A, 7w1m_H, 5und_A, 8ssu_A, 2i13_A, 5kkq_D, 7eyi_G, 5yel_A, 7n5w_A, 1mey_C, 6wmi_A, 5k5i_A, 2gli_A, 1tf6_A, 6ml4_A, 6blw_A, 8h9h_G, 4m9v_C, 2lt7_A, 2jpa_A, 1ubd_C, 3uk3_C, 1tf3_A, 6jnm_A, 7txc_E, 5kl3_A, 1llm_D, 2wbs_A, 6e94_A, 7ysf_A, 7y3m_I, 6a57_A, 8cuc_F, 6u9q_A, 2drp_D, 1g2f_F, 4x9j_A, 7y3l_A, 5k5l_F, 8gn3_A, 5yj3_D |
| Binding Motifs: | ZSCAN29_2 ccGyrTARmCGKCTAYrCrg ZSCAN29_methyl_1 cmGyrTAGmCGkCTACACar |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.