Transcription Factor

Accessions: 4rb2_D (3D-footprint 20260701)
Names: DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family), V6F4Q0_MAGGM
Organisms: Magnetospirillum gryphiswaldense, strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: V6F4Q0
Length: 134
Pfam Domains: 12-130 Ferric uptake regulator family
Sequence:
(in bold interface residues)
1 MVSRIEQRCIDKGMKMTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVR 60
61 LFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGF 120
121 RLVGHRLELYGVPL
Interface Residues: 15, 37, 51, 52, 53, 54, 56, 57, 60, 61, 64, 78
3D-footprint Homologues: 7vpz_N, 4rb3_D, 7vo0_N, 7x74_H, 6jgx_B
Binding Motifs: 4rb2_CD TnnnTGCAAAnnnTnTGC
4rb2_D TTTGCAnntA
Binding Sites: 4rb2_A
4rb2_B
Publications: Deng Z, Wang Q, Liu Z, Zhang M, Machado AC, Chiu TP, Feng C, Zhang Q, Yu L, Qi L, Zheng J, Wang X, Huo X, Qi X, Li X, Wu W, Rohs R, Li Y, Chen Z. Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator. Nat Commun : (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.