Transcription Factor
| Accessions: | 1le8_A (3D-footprint 20260701) |
| Names: | MATa1 protein, MATA1_YEASX, MATING-TYPE PROTEIN A-1, Mating-type protein A1 |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0CY10 |
| Length: | 53 |
| Pfam Domains: | 3-53 Homeobox domain 25-51 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 KSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK |
| Interface Residues: | 1, 39, 40, 42, 43, 46, 47, 49, 50, 51 |
| 3D-footprint Homologues: | 1au7_A, 3d1n_M, 2hos_A, 5zfz_A, 2lkx_A, 6a8r_A, 2hdd_A, 5jlw_D, 2ld5_A, 8ik5_C, 1le8_A, 7q3o_C, 4j19_B, 2xsd_C, 1ig7_A, 7xrc_C, 1e3o_C, 8osb_E, 7psx_B, 4cyc_A, 2r5y_A, 1puf_B, 8eml_B, 1fjl_B, 6es3_K, 4xrs_G, 1nk2_P, 1b72_A, 1zq3_P, 8g87_X, 6fqp_B, 5flv_I, 3lnq_A, 8pmf_A, 1o4x_A, 1du0_A, 5zjt_E, 4qtr_D, 3a01_E, 1jgg_B, 6fqq_E, 5hod_A, 3rkq_B, 9b8u_A, 1puf_A, 8bx1_A, 4xrm_B, 3cmy_A, 8pi8_B, 2h8r_B |
| Binding Motifs: | 1le8_A TTACnTCA 1le8_AB GnAnnannTTACATCA |
| Binding Sites: | 1le8_C 1le8_D |
| Publications: | Ke A, Mathias J.R, Vershon A.K, Wolberger C. Structural and thermodynamic characterization of the DNA binding properties of a triple alanine mutant of MATalpha2. Structure (London, England : 1993) 10:961-71 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.