Transcription Factor

Accessions: 1le8_A (3D-footprint 20231221)
Names: MATa1 protein, MATA1_YEASX, MATING-TYPE PROTEIN A-1, Mating-type protein A1
Organisms: Saccharomyces cerevisiae
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CY10
Length: 53
Pfam Domains: 3-53 Homeobox domain
25-51 Homeobox KN domain
Sequence:
(in bold interface residues)
1 KSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Interface Residues: 1, 39, 40, 42, 43, 46, 47, 50, 51
3D-footprint Homologues: 2hos_A, 1au7_A, 3l1p_A, 5zfz_A, 2lkx_A, 2hdd_A, 6a8r_A, 3d1n_M, 5jlw_D, 2ld5_A, 1e3o_C, 2xsd_C, 7q3o_C, 4j19_B, 1le8_A, 7xrc_C, 1ig7_A, 1o4x_A, 7psx_B, 4cyc_A, 2h1k_B, 1jgg_B, 6es3_K, 4xrs_G, 1puf_A, 1fjl_B, 3a01_E, 6fqp_B, 1b72_A, 5flv_I, 3lnq_A, 1puf_B, 5zjt_E, 4qtr_D, 3cmy_A, 1nk2_P, 6fqq_E, 1du0_A, 5hod_A, 3rkq_B, 2r5y_A, 1zq3_P, 8g87_X, 4xrm_B, 1ic8_B, 2h8r_B
Binding Motifs: 1le8_A TTACnTCA
1le8_AB GnAnnannTTACATCA
Binding Sites: 1le8_C
1le8_D
Publications: Ke A, Mathias J.R, Vershon A.K, Wolberger C. Structural and thermodynamic characterization of the DNA binding properties of a triple alanine mutant of MATalpha2. Structure (London, England : 1993) 10:961-71 (2002). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.