Transcription Factor
| Accessions: | JUND_HUMAN (HOCOMOCO 10), P17535 (JASPAR 2024) |
| Names: | JUND_HUMAN, Transcription factor AP-1 subunit JunD, Transcription factor JunD |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P17535 |
| Length: | 347 |
| Pfam Domains: | 1-257 Jun-like transcription factor 266-328 bZIP transcription factor 271-326 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA 60 61 ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS 120 121 SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG 180 181 ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK 240 241 DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV 300 301 KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY |
| Interface Residues: | 274, 275, 277, 278, 279, 281, 282, 285, 286, 289 |
| 3D-footprint Homologues: | 1gd2_G, 7x5e_F, 2wt7_A, 2wt7_B, 1skn_P, 4eot_A, 7x5e_E, 1nwq_C, 5t01_B, 5vpe_C, 5vpe_D, 1dh3_C, 2dgc_A |
| Binding Motifs: | MA0491.1 drTGAsTCATs MA0492.1 wrwrATGAyGTMATm JUND_HUMAN.H10MO.A|M01282 grTGAGTCAyc MA1141.1 kkrTGAGTCAymv MA1142.1 rrTGActmAt MA1143.1 rTGACgymay MA1144.1 krTGAsTCAy MA1145.1 kkrTkACGTCAycgc MA0491.2 wraTGACTCAThh MA0491.3 aTGACTCAT MA0492.2 rATGAyGTMAT MA1141.2 rTGAGTCAy MA1142.2 rTGActmA MA1143.2 rTGACgyma MA1144.2 rTGAsTCAy MA1145.2 rTkACGTCAy |
| Binding Sites: | MA0491.1.1 MA0491.1.10 MA0491.1.11 MA0491.1.12 MA0491.1.13 MA0491.1.14 MA0491.1.15 MA0491.1.16 MA0491.1.17 MA0491.1.18 MA0491.1.19 MA0491.1.2 MA0491.1.20 MA0491.1.3 MA0491.1.4 MA0491.1.5 MA0491.1.6 MA0491.1.7 MA0491.1.8 MA0491.1.9 MA0492.1.1 MA0492.1.10 MA0492.1.11 MA0492.1.12 MA0492.1.13 MA0492.1.14 MA0492.1.15 MA0492.1.16 MA0492.1.17 MA0492.1.18 MA0492.1.19 MA0492.1.2 MA0492.1.20 MA0492.1.3 MA0492.1.4 MA0492.1.5 MA0492.1.6 MA0492.1.7 MA0492.1.8 MA0492.1.9 MA0491.2.2 / MA0491.2.3 MA0491.2.15 MA0491.2.20 MA0491.2.8 MA0491.2.10 MA0491.2.11 MA0491.2.4 MA0491.2.13 MA0491.2.5 MA0491.2.6 MA0491.2.3 MA0491.2.9 MA0491.2.10 / MA0491.2.4 MA0491.2.14 / MA0491.2.6 MA0491.2.12 MA0491.2.14 MA0491.2.15 MA0491.2.16 MA0491.2.17 MA0491.2.13 MA0491.2.16 MA0491.2.17 / MA0491.2.7 MA0491.2.1 MA0491.2.11 MA0491.2.12 / MA0491.2.5 MA0491.2.18 MA0491.2.19 MA0491.2.1 / MA0491.2.2 MA0491.2.7 MA0491.2.8 MA0491.2.18 MA0491.2.19 MA0491.2.20 MA0491.2.9 MA0491.3.2 MA0491.3.13 / MA0491.3.5 MA0491.3.14 MA0491.3.1 / MA0491.3.15 MA0491.3.16 MA0491.3.17 / MA0491.3.4 MA0491.3.18 MA0491.3.19 MA0491.3.3 MA0491.3.11 / MA0491.3.12 / MA0491.3.6 / MA0491.3.8 MA0491.3.10 MA0491.3.7 MA0491.3.20 MA0491.3.9 MA0492.2.1 MA0492.2.10 MA0492.2.11 MA0492.2.12 MA0492.2.13 MA0492.2.14 MA0492.2.15 MA0492.2.16 MA0492.2.17 MA0492.2.18 MA0492.2.19 MA0492.2.2 MA0492.2.20 MA0492.2.3 MA0492.2.4 MA0492.2.5 MA0492.2.6 MA0492.2.7 MA0492.2.8 MA0492.2.9 |
| Publications: | Colin L, Vandenhoudt N, de Walque S, Van Driessche B, Bergamaschi A, Martinelli V, Cherrier T, Vanhulle C, Guiguen A, David A, Burny A, Herbein G, Pancino G, Rohr O, Van Lint C. The AP-1 binding sites located in the pol gene intragenic regulatory region of HIV-1 are important for viral replication. PloS one 6:e19084 (2011). [Pubmed] Shaulian E, Karin M. AP-1 as a regulator of cell life and death. Nat Cell Biol : (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.