Transcription Factor

Accessions: T093317_1.02 (CISBP 1.02), P52954 (JASPAR 2024)
Names: LBX1, T093317_1.02;, Ladybird homeobox protein homolog 1, LBX1_HUMAN, Transcription factor LBX1
Organisms: Homo sapiens
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:Homeodomain
Length: 281
Pfam Domains: 126-182 Homeobox domain
Sequence:
(in bold interface residues)
1 MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLL 60
61 AAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ 120
121 TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL 180
181 KRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPG 240
241 APKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD
Interface Residues: 124, 125, 126, 127, 128, 129, 167, 168, 170, 171, 174, 175, 177, 178, 179, 182
3D-footprint Homologues: 6fqp_B, 5zfz_A, 4j19_B, 6a8r_A, 3cmy_A, 8ejp_B, 1fjl_B, 3d1n_M, 1puf_A, 1ig7_A, 8pmf_A, 1nk2_P, 1zq3_P, 2lkx_A, 3lnq_A, 1jgg_B, 6es3_K, 7q3o_C, 1puf_B, 2ld5_A, 8ik5_C, 6m3d_C, 5jlw_D, 4cyc_A, 4xrs_G, 2hdd_A, 8osb_E, 7psx_B, 1b72_A, 2r5y_A, 8eml_B, 5flv_I, 2hos_A, 5zjt_E, 3a01_E, 5hod_A, 3rkq_B, 9b8u_A, 1e3o_C, 1le8_A, 8bx1_A, 4xrm_B, 1k61_B, 1o4x_A, 1mnm_C, 1du0_A, 4qtr_D, 8g87_X, 6fqq_E
Binding Motifs: M0894_1.02 tTAAYTRG
MA0618.1 tTAAYTRG
MA0618.2 TAAYTRG
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.