Transcription Factor

Accessions: 5cbz_F (3D-footprint 20241219)
Names: AncMR DNA Binding Domain, GCR_HUMAN, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P04150
Length: 73
Pfam Domains: 4-71 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 PSKVCLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC 60
61 RLRKCLQAGMNLG
Interface Residues: 14, 16, 23, 26, 27, 30, 31, 55
3D-footprint Homologues: 6l6q_B, 7wnh_D, 3g9m_B, 7xv6_B, 2han_A, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 2ff0_A, 3g6t_A, 8rm6_A, 7prw_B, 5cbx_B, 5cbz_E
Binding Motifs: 5cbz_EF GnrCAnnnTGwnC
Binding Sites: 5cbz_G
5cbz_H
Publications: Hudson WH, Kossmann BR, de Vera IM, Chuo SW, Weikum ER, Eick GN, Thornton JW, Ivanov IN, Kojetin DJ, Ortlund EA. Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space. Proc Natl Acad Sci U S A 113:326-31 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.