Transcription Factor
| Accessions: | 1nk2_P (3D-footprint 20231221) |
| Names: | Homeobox protein NK-2, HOMEOBOX PROTEIN VND, Protein ventral nervous system defective, VND_DROME |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P22808 |
| Length: | 77 |
| Pfam Domains: | 10-66 Homeobox domain |
| Sequence: (in bold interface residues) | 1 ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNH 60 61 RYKTKRAQNEKGYEGHP |
| Interface Residues: | 10, 11, 12, 13, 51, 52, 54, 55, 58, 59, 62, 63, 66 |
| 3D-footprint Homologues: | 3d1n_M, 5zfz_A, 1fjl_B, 6a8r_A, 3cmy_A, 1puf_A, 1ig7_A, 1zq3_P, 6m3d_C, 1nk2_P, 2lkx_A, 3l1p_A, 2ld5_A, 7q3o_C, 6es3_K, 2hos_A, 1jgg_B, 5flv_I, 5zjt_E, 3a01_E, 2h1k_B, 7psx_B, 1au7_A, 3lnq_A, 2hdd_A, 1b72_A, 3rkq_B, 2r5y_A, 4xrs_G, 5jlw_D, 7xrc_C, 2xsd_C, 1e3o_C, 4j19_B, 1le8_A, 1mnm_C, 1du0_A, 4cyc_A, 8g87_X, 1k61_B, 5hod_A, 1o4x_A, 4qtr_D |
| Binding Motifs: | 1nk2_P GTcaA |
| Binding Sites: | 1nk2_A 1nk2_B |
| Publications: | Gruschus J.M, Tsao D.H, Wang L.H, Nirenberg M, Ferretti J.A. Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity. Biochemistry 36:5372-80 (1997). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.