Transcription Factor
| Accessions: | E2F1_DBD (HumanTF 1.0), E2F1_TF1 (HumanTF2 1.0) |
| Names: | E2F-1, E2F1, E2F1_HUMAN, PBR3, pRB-binding protein E2F-1, RBAP-1, RBBP-3, Retinoblastoma-associated protein 1, Retinoblastoma-binding protein 3, Transcription factor E2F1 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Uniprot: | Q01094 |
| Notes: | Ensembl ID: ENSG00000101412; DNA-binding domain sequence; TF family: E2F; Clone source: hORFeome, Ensembl ID: ENSG00000101412; Construct type: TF1(SBP); TF family: E2F; Clone source: Jolma et al. 2013 |
| Length: | 111 |
| Pfam Domains: | 25-90 E2F/DP family winged-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 ESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKV 60 61 QKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQL |
| Interface Residues: | 25, 61, 62, 63, 64, 66 |
| 3D-footprint Homologues: | 1cf7_A, 4yo2_A, 1cf7_B |
| Binding Motifs: | E2F1_DBD_1 wwtGGCGCCaAa E2F1_DBD_2 tttGGCGCCaaa E2F1_ELK1_1 sGCGssyrAmCGGAAGt E2F1_ELK1_2 sGCGcshwtwkggrsCGGAAGt E2F1_ELK1_2_3 sGCGcsywdkkkrrrsCGGAAGT E2F1_EOMES_1 vrGTGtGaAwgGCGCsywkCac E2F1_EOMES_2 rsGYGtsrwGGCGsywTgdCrbgg E2F1_HES7_1 ggCACGTGcCrwtsGCGCsm E2F1_HES7_2 grCrCGTGsyrywaGGCGCsm E2F1_NHLH1 sGCGCswyrmygkkgcmGCAGCTGCk |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.