Transcription Factor

Accessions: opa (FlyZincFinger 1.0 )
Names: CG1133
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 175
Pfam Domains: 68-93 Zinc-finger double domain
81-105 C2H2-type zinc finger
81-105 Zinc finger, C2H2 type
97-124 Zinc-finger double domain
111-135 C2H2-type zinc finger
129-154 Zinc-finger double domain
141-165 C2H2-type zinc finger
141-165 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 QCLWIDPDQPGLVPPGGRKTCNKVFHSMHEIVTHLTVEHVGGPECTTHACFWVGCSRNGR 60
61 PFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHTGEKPFKCEHEGCDR 120
121 RFANSSDRKKHSHVHTSDKPYNCRINGCDKSYTHPSSLRKHMKVHGNVDEKSPSH
Interface Residues: 27, 29, 30, 33, 36, 63, 64, 66, 67, 69, 70, 72, 73, 74, 76, 93, 94, 95, 96, 97, 99, 100, 101, 123, 124, 125, 126, 127, 128, 129, 130, 131, 134, 153, 154, 155, 156, 157, 159, 160
3D-footprint Homologues: 5v3j_F, 2lt7_A, 7w1m_H, 8cuc_F, 1tf3_A, 1g2f_F, 5kkq_D, 1tf6_A, 5ei9_F, 5k5i_A, 2gli_A, 6ml4_A, 2i13_A, 8gn3_A, 6e94_A, 7ysf_A, 6wmi_A, 7n5w_A, 8h9h_G, 5und_A, 7eyi_G, 2jpa_A, 1ubd_C, 3uk3_C, 6jnm_A, 7y3l_A, 4x9j_A, 6blw_A, 6u9q_A, 5yel_A, 1llm_D, 7txc_E, 5kl3_A, 2kmk_A, 8ssq_A, 1mey_C, 1f2i_J, 4m9v_C, 7y3m_I, 6a57_A, 2wbs_A, 5yj3_D, 5k5l_F
Binding Motifs: opa_NAR_FBgn0003002 GmCCCCCCGCtG
opa_SOLEXA_FBgn0003002 mmmsmCCCCCCrcbG
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.