Transcription Factor
| Accessions: | CREB1_HUMAN (HOCOMOCO 10), P16220 (JASPAR 2024) |
| Names: | cAMP-responsive element-binding protein 1, CREB-1, CREB1_HUMAN, Cyclic AMP-responsive element-binding protein 1 |
| Organisms: | Homo sapiens, Rattus norvegicus |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 341 |
| Pfam Domains: | 113-153 pKID domain 281-338 bZIP transcription factor 286-333 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN 60 61 GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD 120 121 SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG 180 181 QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV 240 241 VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC 300 301 RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD |
| Interface Residues: | 289, 293, 294, 296, 297, 300, 301 |
| 3D-footprint Homologues: | 7x5e_F, 4eot_A, 5vpe_D, 1dh3_C, 8k86_A, 5t01_B |
| Binding Motifs: | MA0018.2 TGACGYcA CREB1_HUMAN.H10MO.A|M01064 TkaCGTCAycr MA0018.1 bbkGrTGACGym MA0018.3 grTGACGTCAyc MA0018.4 wdrTGATGTCAyh MA0018.5 TGATGTCA |
| Binding Sites: | MA0018.5.1 / MA0018.5.10 / MA0018.5.11 / MA0018.5.12 / MA0018.5.13 / MA0018.5.14 / MA0018.5.2 / MA0018.5.3 / MA0018.5.4 / MA0018.5.6 / MA0018.5.7 / MA0018.5.9 MA0018.2.7 MA0018.5.18 MA0018.1.1 MA0018.1.10 MA0018.1.11 MA0018.1.12 MA0018.1.13 MA0018.1.14 MA0018.1.15 MA0018.1.16 MA0018.1.2 MA0018.1.3 MA0018.1.4 MA0018.1.5 MA0018.1.6 MA0018.1.7 MA0018.1.8 MA0018.1.9 MA0018.2.1 MA0018.2.10 MA0018.2.11 MA0018.2.2 MA0018.2.3 MA0018.2.4 MA0018.2.5 MA0018.2.6 MA0018.2.8 MA0018.2.9 MA0018.3.1 MA0018.3.10 MA0018.3.11 / MA0018.3.12 MA0018.3.13 MA0018.3.14 MA0018.3.15 MA0018.3.16 MA0018.3.17 MA0018.3.18 MA0018.3.19 MA0018.3.2 MA0018.3.20 MA0018.3.3 MA0018.3.4 MA0018.3.5 MA0018.3.6 MA0018.3.7 MA0018.3.8 MA0018.3.9 MA0018.5.20 MA0018.4.1 MA0018.4.10 MA0018.4.11 MA0018.4.12 MA0018.4.13 MA0018.4.14 MA0018.4.15 MA0018.4.16 / MA0018.4.6 MA0018.4.17 / MA0018.4.7 MA0018.4.18 MA0018.4.19 / MA0018.4.8 MA0018.4.2 MA0018.4.10 / MA0018.4.20 / MA0018.4.9 MA0018.4.3 MA0018.4.4 MA0018.4.5 MA0018.4.6 MA0018.4.7 MA0018.4.8 MA0018.4.5 / MA0018.4.9 MA0018.4.20 MA0018.4.11 MA0018.4.12 MA0018.4.13 MA0018.4.14 MA0018.4.15 MA0018.4.16 MA0018.4.17 MA0018.4.18 MA0018.4.19 MA0018.5.15 MA0018.5.16 / MA0018.5.17 MA0018.5.19 MA0018.5.5 MA0018.5.8 |
| Publications: | Paca-Uccaralertkun S., Zhao L.-J., Adya N., Cross J. V., Cullen B. R., Boros I. M., Giam C.-Z. In vitro selection of DNA elements highly responsive to the human T-cell lymphotropic virus type I transcriptional activator, Tax. Mol. Cell. Biol. 14:456-462 (1994). [Pubmed] Portales-Casamar E, Kirov S, Lim J, Lithwick S, Swanson M.I, Ticoll A, Snoddy J, Wasserman W.W. PAZAR: a framework for collection and dissemination of cis-regulatory sequence annotation. Genome biology 8:R207 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.