Transcription Factor
| Accessions: | Pou2f2_DBD (HumanTF 1.0) |
| Names: | Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2, Oct-2, Octamer-binding protein 2, Octamer-binding transcription factor 2, OTF-2, PO2F2_MOUSE, POU domain, class 2, transcription factor 2, Pou2f2 |
| Organisms: | Mus musculus |
| Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Uniprot: | Q00196 |
| Notes: | Ensembl ID: ENSMUSG00000008496; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Hughes lab. |
| Length: | 195 |
| Pfam Domains: | 17-90 Pou domain - N-terminal to homeobox domain 119-175 Homeobox domain |
| Sequence: (in bold interface residues) | 1 LPTQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQT 60 61 TISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRK 120 121 KRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCS 180 181 AAPMLPSPGKPTSYS |
| Interface Residues: | 42, 58, 59, 60, 61, 63, 64, 70, 74, 119, 120, 121, 122, 160, 161, 163, 164, 167, 168, 170, 171, 172, 175 |
| 3D-footprint Homologues: | 7u0g_M, 3d1n_M, 8bx1_A, 1o4x_A, 1e3o_C, 1au7_A, 7xrc_C, 8g87_X, 2xsd_C, 8ejp_B, 1puf_A, 3cmy_A, 8pmf_A, 1fjl_B, 6a8r_A, 1ig7_A, 2lkx_A, 1zq3_P, 1nk2_P, 7q3o_C, 6es3_K, 8ik5_C, 3a01_E, 8osb_E, 3rkq_B, 8eml_B, 2r5y_A, 1b72_A, 5hod_A, 5jlw_D, 2ld5_A, 1le8_A, 1du0_A, 3lnq_A, 1jgg_B, 6fqp_B, 4xrs_G, 5zjt_E, 6fqq_E, 5flv_I, 4cyc_A, 7psx_B, 2d5v_B, 4qtr_D |
| Binding Motifs: | Pou2f2_DBD_1 ywTGMATATkCAwa Pou2f2_DBD_2 TATGCAAAT |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.