Transcription Factor
| Accessions: | SNAI1_HUMAN (HOCOMOCO 10), O95863 (JASPAR 2024) |
| Names: | Protein snail homolog 1, SNAI1_HUMAN, Zinc finger protein SNAI1 |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | O95863 |
| Length: | 264 |
| Pfam Domains: | 154-176 Zinc finger, C2H2 type 154-176 C2H2-type zinc finger 154-176 C2H2-type zinc finger 181-202 Zinc finger, C2H2 type 182-202 C2H2-type zinc finger 182-190 C2H2-type zinc finger 195-218 Zinc-finger double domain 208-230 C2H2-type zinc finger 208-230 Zinc finger, C2H2 type 208-230 C2H2-type zinc finger 222-247 Zinc-finger double domain 236-256 C2H2-type zinc finger 236-259 Zinc finger, C2H2 type 236-260 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI 60 61 WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS 120 121 LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC 180 181 VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA 240 241 CARTFSRMSLLHKHQESGCSGCPR |
| Interface Residues: | 154, 164, 165, 166, 167, 168, 170, 171, 173, 174, 177, 190, 191, 192, 193, 194, 196, 197, 198, 218, 219, 220, 221, 222, 223, 224, 225, 226, 229, 246, 247, 248, 249, 250, 252, 253 |
| 3D-footprint Homologues: | 2kmk_A, 7n5w_A, 6jnm_A, 8ssu_A, 5kkq_D, 5ei9_F, 5kl3_A, 1ubd_C, 6ml4_A, 8ssq_A, 7w1m_H, 6blw_A, 8h9h_G, 6e94_A, 7ysf_A, 2gli_A, 6a57_A, 2jpa_A, 1tf3_A, 8cuc_F, 7y3l_A, 3uk3_C, 6u9q_A, 5yel_A, 4x9j_A, 1f2i_J, 1tf6_A, 1g2f_F, 7txc_E, 5k5i_A, 1llm_D, 5v3j_F, 4m9v_C, 2lt7_A, 7y3m_I, 5k5l_F, 2wbs_A, 8gn3_A, 5yj3_D, 2drp_D |
| Binding Motifs: | MA1558.1 drCAGGTGyr SNAI1_HUMAN.H10MO.C|M01506 cCAGGTGg MA1558.2 rCAGGTG |
| Publications: | Kumar B, Uppuladinne MV, Jani V, Sonavane U, Joshi RR, Bapat SA. Auto-regulation of Slug mediates its activity during epithelial to mesenchymal transition. Biochim Biophys Acta 1849:1209-18 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.