Transcription Factor

Accessions: IRF5 (HT-SELEX2 May2017)
Names: ENSG00000128604, IRF5
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: IRF experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: IRF experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: IRF experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: IRF experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 139
Pfam Domains: 13-121 Interferon regulatory factor transcription factor
Sequence:
(in bold interface residues)
1 NQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDN 60
61 TIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVC 120
121 SNGPAPTDSQPPEDYSFGA
Interface Residues: 48, 50, 83, 87, 88, 90, 91, 94, 95
3D-footprint Homologues: 2pi0_B, 1if1_B, 2o61_A, 2irf_L, 7oot_B
Binding Motifs: IRF5_2 cCGAAACCGAaACy
IRF5_4 cCGAAACCGAAACy
IRF5_methyl_1 vyGAAACcGAwACy
IRF5_methyl_3 syGAAACCGAAACy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.