Transcription Factor

Accessions: TGIF2LX_full (HumanTF 1.0)
Names: Homeobox protein TGIF2LX, TF2LX_HUMAN, TGF-beta-induced transcription factor 2-like protein, TGFB-induced factor 2-like protein, X-linked, TGIF-like on the X, TGIF2LX
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q8IUE1
Notes: Ensembl ID: ENSG00000153779; Full protein sequence; TF family: homeodomain+MEIS; Clone source: Megaman
Length: 242
Pfam Domains: 68-107 Homeobox KN domain
74-107 Homeobox domain
Sequence:
(in bold interface residues)
1 MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAE 60
61 SVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDP 120
121 IIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPS 180
181 QKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPN 240
241 P*
Interface Residues: 51, 53, 54, 55, 56, 95, 96, 98, 99, 102, 103, 104, 106, 107
3D-footprint Homologues: 6fqp_B, 1mnm_C, 1puf_B, 2ld5_A, 1k61_B, 1le8_B, 1le8_A, 1fjl_B, 4xrm_B, 2d5v_B, 6fqq_E
Binding Motifs: TGIF2LX_full TGACAGsTGTCA
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.