Transcription Factor
| Accessions: | 4yg1_A (3D-footprint 20260701) |
| Names: | Antitoxin HipB, HIPB_ECOLI |
| Organisms: | Escherichia coli, strain K12 |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P23873 |
| Length: | 72 |
| Pfam Domains: | 12-67 Helix-turn-helix domain 12-65 Helix-turn-helix domain 16-67 Helix-turn-helix domain 18-69 Helix-turn-helix 22-67 Cro/C1-type HTH DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKI 60 61 LQSLELSMTLCD |
| Interface Residues: | 28, 29, 38, 39, 40, 41, 43, 44, 47, 50, 51 |
| 3D-footprint Homologues: | 1per_L, 3cro_R, 3oqm_C, 3zkc_A, 5k98_B, 3dnv_B, 4z5h_A, 5gpc_B, 4lln_I |
| Binding Motifs: | 4yg1_ABCD TATCnnnnnnnATGnTAnnnnnnnnnnnATnCnnnnnnCGGATA |
| Publications: | Schumacher MA, Balani P, Min J, Chinnam NB, Hansen S, Vulić M, Lewis K, Brennan RG. HipBA-promoter structures reveal the basis of heritable multidrug tolerance. Nature 524:59-64 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.