Transcription Factor

						

			
Accessions: 1qp9_A (3D-footprint 20231221)

			
Names: CYP1 activatory protein, CYP1(HAP1-PC7) ACTIVATORY PROTEIN, HAP1_YEASX, Heme activator protein 1, Heme-responsive zinc finger transcription factor HAP1
Organisms: Saccharomyces cerevisiae
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CS82
Length: 76
Pfam Domains:      9-43 Fungal Zn(2)-Cys(6) binuclear cluster domain
Sequence: 
(in bold interface residues)		   1 RKRNRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNEL   60
  61 KKLRERVKSLEKTLSK
Interface Residues: 16, 17, 18, 19, 21, 22, 25
3D-footprint Homologues: 1hwt_C, 1pyi_A, 6o19_A, 2er8_C, 3coq_A, 6gys_C, 7uik_T, 1zme_D, 1d66_B, 7eyi_G, 8h9h_G, 7n5w_A, 7y3l_A
Binding Motifs: 1qp9_AB CGCnnnTATCGCnnnTAG
			
Publications: Lukens A.K, King D.A, Marmorstein R. Structure of HAP1-PC7 bound to DNA: implications for DNA recognition and allosteric effects of DNA-binding on transcriptional activation. Nucleic acids research 28:3853-63 (2000). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.