Transcription Factor
| Accessions: | 2erg_A (3D-footprint 20231221), 2erg_B (3D-footprint 20231221) |
| Names: | LEUR_YEAST, Regulatory protein LEU3 |
| Organisms: | Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P08638 |
| Length: | 65 |
| Pfam Domains: | 2-41 Fungal Zn(2)-Cys(6) binuclear cluster domain |
| Sequence: (in bold interface residues) | 1 FACVECRQQKSKCDACERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTR 60 61 TLTNL |
| Interface Residues: | 5, 7, 9, 10, 11, 12, 14, 15, 18, 28, 29, 30, 40, 41 |
| 3D-footprint Homologues: | 1s40_A, 1f5e_P, 1hwt_C, 2er8_C, 6o19_A, 1pyi_A, 1d66_B, 7uik_T, 3coq_A, 1zme_D, 6gys_C, 2r5y_A, 7vyx_B |
| Binding Motifs: | 2erg_A ccGG 2erg_AB CCGgnncCGG |
| Binding Sites: | 2erg_C / 2erg_D |
| Publications: | Fitzgerald M.X, Rojas J.R, Kim J.M, Kohlhaw G.B, Marmorstein R. Structure of a Leu3-DNA complex: recognition of everted CGG half-sites by a Zn2Cys6 binuclear cluster protein. Structure (London, England : 1993) 14:725-35 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.