Transcription Factor

Accessions: 2erg_A (3D-footprint 20250804), 2erg_B (3D-footprint 20250804)
Names: LEUR_YEAST, Regulatory protein LEU3
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08638
Length: 65
Pfam Domains: 2-41 Fungal Zn(2)-Cys(6) binuclear cluster domain
Sequence:
(in bold interface residues)
1 FACVECRQQKSKCDACERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTR 60
61 TLTNL
Interface Residues: 5, 7, 9, 10, 11, 12, 14, 15, 18, 28, 29, 30, 40, 41
3D-footprint Homologues: 1s40_A, 1f5e_P, 6o19_A, 1pyi_A, 2er8_C, 7uik_T, 3coq_A, 1d66_B, 1zme_D, 6gys_C, 2r5y_A, 7vyx_B
Binding Motifs: 2erg_A ccGG
2erg_AB CCGgnncCGG
Binding Sites: 2erg_C / 2erg_D
Publications: Fitzgerald M.X, Rojas J.R, Kim J.M, Kohlhaw G.B, Marmorstein R. Structure of a Leu3-DNA complex: recognition of everted CGG half-sites by a Zn2Cys6 binuclear cluster protein. Structure (London, England : 1993) 14:725-35 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.