Transcription Factor

Accessions: ECK120005767 (RegulonDB 7.5)
Names: NrdR
Organisms: ECK12
Libraries: RegulonDB 7.5 1
1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed]
Notes: NrdR is a zinc finger/ATP cone transcriptional regulatory protein that regulates the expression of several operonsencoding ribonucleotide reductases; The protein binds Zn2+ and contains ATP/dATPTorrents E,2007.NrdR was first identified as a potential regulator of ribonucleotide reductase genes by phylogenetic profilingRodionov DA,2005.nrdR is expressed at similar levels during exponential and stationary phase growth and is not required forgrowth Torrents E,2007.NrdR: nrd regulation Rodionov DA,2005Review: Herrick J,2007; repressor; metal ion binding; ATP binding; negative regulation of transcription, DNA-dependent; transcription repressor activity; double-stranded DNA binding; nucleotide binding
Length: 150
Pfam Domains: 50-136 ATP cone domain
Sequence:
(in bold interface residues)
1 MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP 60
61 FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVPSKMIGNLVMEQLKKLD 120
121 KVAYIRFASVYRSFEDIKEFGEEIARLED*
Interface Residues: 15, 17, 40, 41, 42, 47, 77
3D-footprint Homologues: 7p3f_A, 2lt7_A
Binding Motifs: NrdR cACwAyATmTwGsrktk
Binding Sites: ECK120033054
ECK120033056
ECK120033058
ECK120033060
ECK120033062
ECK120033064
Publications: Rodionov DA., Gelfand MS. Identification of a bacterial regulatory system for ribonucleotide reductases by phylogenetic profiling. Trends Genet. 21(7):385-9 (2005). [Pubmed]

Herrick J., Sclavi B. Ribonucleotide reductase and the regulation of DNA replication: an old story and an ancient heritage. Mol Microbiol. 63(1):22-34 (2007). [Pubmed]

Torrents E., Grinberg I., Gorovitz-Harris B., Lundstrom H., Borovok I., Aharonowitz Y., Sjoberg BM., Cohen G. NrdR controls differential expression of the Escherichia coli ribonucleotide reductase genes. J Bacteriol. 189(14):5012-21 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.