Transcription Factor

Accessions: crol-F7-16 (FlyZincFinger 1.0 )
Names: CG14938
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 284
Pfam Domains: 1-15 Zinc-finger double domain
5-27 Zinc finger, C2H2 type
5-27 C2H2-type zinc finger
6-28 Zinc-finger of C2H2 type
19-44 Zinc-finger double domain
33-55 Zinc finger, C2H2 type
33-55 C2H2-type zinc finger
33-51 Zinc-finger of C2H2 type
48-72 Zinc-finger double domain
61-83 Zinc finger, C2H2 type
61-83 C2H2-type zinc finger
62-81 Zinc-finger of C2H2 type
75-100 Zinc-finger double domain
89-111 Zinc finger, C2H2 type
89-111 C2H2-type zinc finger
103-128 Zinc-finger double domain
117-139 Zinc finger, C2H2 type
117-139 C2H2-type zinc finger
132-156 Zinc-finger double domain
145-167 Zinc finger, C2H2 type
145-167 C2H2-type zinc finger
159-184 Zinc-finger double domain
173-195 C2H2-type zinc finger
173-195 Zinc finger, C2H2 type
187-212 Zinc-finger double domain
201-223 C2H2-type zinc finger
201-224 C2H2 type zinc-finger (2 copies)
201-223 Zinc finger, C2H2 type
202-221 Zinc-finger of C2H2 type
215-240 Zinc-finger double domain
229-252 C2H2-type zinc finger
230-252 Zinc finger, C2H2 type
230-248 Zinc-finger of C2H2 type
244-267 Zinc-finger double domain
258-280 Zinc finger, C2H2 type
258-280 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 GQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETP 60
61 HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCT 120
121 YCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKK 180
181 TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR 240
241 KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQ
Interface Residues: 15, 16, 18, 19, 21, 22, 33, 43, 44, 45, 46, 47, 49, 50, 52, 53, 56, 71, 72, 73, 74, 75, 78, 82, 99, 100, 101, 102, 103, 105, 106, 127, 128, 129, 130, 131, 134, 138, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 183, 184, 185, 186, 187, 188, 190, 191, 193, 212, 213, 214, 215, 217, 218, 224, 238, 239, 240, 241, 242, 243, 245, 246, 251, 268, 269, 270, 271, 272, 275
3D-footprint Homologues: 1tf3_A, 8cuc_F, 8ssu_A, 1tf6_A, 5k5i_A, 1llm_D, 8ssq_A, 7w1m_H, 6e94_A, 2lt7_A, 8gn3_A, 2kmk_A, 5ei9_F, 7txc_E, 5yel_A, 2jpa_A, 5kkq_D, 1g2f_F, 5kl3_A, 5v3j_F, 4x9j_A, 7ysf_A, 7y3l_A, 1f2i_J, 2wbs_A, 6ml4_A, 7y3m_I, 6blw_A, 5k5l_F, 1ubd_C, 7n5w_A, 6jnm_A, 2gli_A, 6u9q_A, 8h9h_G, 4m9v_C, 6a57_A, 2drp_D, 3uk3_C, 5yj3_D
Binding Motifs: crol-F7-16_SOLEXA_FBgn0020309 gggbGsGGGGGGGrg
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.