Transcription Factor

						

			
Accessions: crol-F7-16 (FlyZincFinger 1.0 )

			
Names: CG14938
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 284
Pfam Domains:      1-15 Zinc-finger double domain
     5-27 Zinc finger, C2H2 type
     5-27 C2H2-type zinc finger
     6-28 Zinc-finger of C2H2 type
    19-44 Zinc-finger double domain
    33-55 C2H2-type zinc finger
    33-51 Zinc-finger of C2H2 type
    33-55 Zinc finger, C2H2 type
    48-72 Zinc-finger double domain
    61-83 C2H2-type zinc finger
    61-83 Zinc finger, C2H2 type
    62-81 Zinc-finger of C2H2 type
   75-100 Zinc-finger double domain
   89-111 Zinc finger, C2H2 type
   89-111 C2H2-type zinc finger
  103-128 Zinc-finger double domain
  117-139 Zinc finger, C2H2 type
  117-139 C2H2-type zinc finger
  132-156 Zinc-finger double domain
  145-167 Zinc finger, C2H2 type
  145-167 C2H2-type zinc finger
  159-184 Zinc-finger double domain
  173-195 Zinc finger, C2H2 type
  173-195 C2H2-type zinc finger
  187-212 Zinc-finger double domain
  201-223 Zinc finger, C2H2 type
  201-223 C2H2-type zinc finger
  201-224 C2H2 type zinc-finger (2 copies)
  202-221 Zinc-finger of C2H2 type
  215-240 Zinc-finger double domain
  229-252 C2H2-type zinc finger
  230-248 Zinc-finger of C2H2 type
  230-252 Zinc finger, C2H2 type
  244-267 Zinc-finger double domain
  258-280 C2H2-type zinc finger
  258-280 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 GQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETP   60
  61 HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCT  120
 121 YCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKK  180
 181 TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  240
 241 KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQ
Interface Residues: 15, 16, 18, 19, 21, 22, 33, 43, 44, 45, 46, 47, 49, 50, 52, 53, 56, 71, 72, 73, 74, 75, 78, 82, 99, 100, 101, 102, 103, 105, 106, 127, 128, 129, 130, 131, 134, 138, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 183, 184, 185, 186, 187, 188, 190, 191, 193, 212, 213, 214, 215, 217, 218, 224, 238, 239, 240, 241, 242, 243, 245, 246, 251, 268, 269, 270, 271, 272, 275
3D-footprint Homologues: 1tf3_A, 8cuc_F, 8ssu_A, 1tf6_A, 2i13_A, 1llm_D, 5k5i_A, 8ssq_A, 7w1m_H, 2lt7_A, 6e94_A, 8gn3_A, 2kmk_A, 5ei9_F, 7txc_E, 5und_A, 5yel_A, 2jpa_A, 5v3j_F, 4x9j_A, 5kkq_D, 1mey_C, 5kl3_A, 1g2f_F, 7ysf_A, 7y3l_A, 6ml4_A, 2wbs_A, 1f2i_J, 6wmi_A, 7y3m_I, 5k5l_F, 6blw_A, 7eyi_G, 1ubd_C, 7n5w_A, 6jnm_A, 6u9q_A, 2gli_A, 8h9h_G, 4m9v_C, 2drp_D, 6a57_A, 3uk3_C, 5yj3_D
Binding Motifs: crol-F7-16_SOLEXA_FBgn0020309 gggbGsGGGGGGGrg
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.