Transcription Factor

Accessions: 6t78_A (3D-footprint 20231221)
Names: SOX11_HUMAN, Transcription factor SOX-11
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P35716
Length: 77
Pfam Domains: 4-72 HMG (high mobility group) box
5-62 Domain of unknown function (DUF1898)
Sequence:
(in bold interface residues)
1 SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERL 60
61 RLKHMADYPDYKYRPRK
Interface Residues: 6, 9, 11, 12, 13, 15, 19, 30, 31, 32, 35, 73, 77
3D-footprint Homologues: 4s2q_D, 1qrv_A, 3tmm_A, 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 7m5w_A, 3f27_D, 1hry_A, 3tq6_B, 1ckt_A
Binding Motifs: 6t78_A TaAATTgT
6t78_AB ACAATAAATTGT
Binding Sites: 6t78_C
6t78_D
Publications: Dodonova SO, Zhu F, Dienemann C, Taipale J, Cramer P. Nucleosome-bound SOX2 and SOX11 structures elucidate pioneer factor function. Nature 580:669-672 (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.