Transcription Factor

Accessions: Aef1 (DrosophilaTF 1.1), T057699_1.02 (CISBP 1.02)
Names: Adult enhancer factor 1, AEF-1, AEF1_DROME, Aef1, T057699_1.02;
Organisms: Drosophila melanogaster
Libraries: DrosophilaTF 1.1 1, CISBP 1.02 2
1 Down T.A, Bergman C.M, Su J, Hubbard T.J. Large-scale discovery of promoter motifs in Drosophila melanogaster. PLoS computational biology 3:e7 (2007). [Pubmed]
2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Uniprot: P39413
Notes: experiment type:B1H, family:C2H2 ZF
Length: 308
Pfam Domains: 180-194 Zinc-finger double domain
184-206 Zinc finger, C2H2 type
184-206 C2H2-type zinc finger
199-222 Zinc-finger double domain
212-232 Zinc-finger of C2H2 type
212-234 Zinc finger, C2H2 type
212-234 C2H2-type zinc finger
227-250 Zinc-finger double domain
240-262 C2H2-type zinc finger
240-262 Zinc finger, C2H2 type
255-278 Zinc-finger double domain
268-288 Zinc-finger of C2H2 type
268-290 C2H2-type zinc finger
268-290 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MMHIKSLPHAHAAATAMSSNCDIVIVAAQPQTTIANNNNNETVTQATHPAHMAAVQQQQQ 60
61 QQQQQQQQHHQQQQQQSSGPPSVPPPPTELPLPFQMHLSGISAEAHSAAQAAAMAAAQAA 120
121 AAQAAAAEQQQPPPPTSHLTHLTTHSPTTIHSEHYLANGHSEHPGEGNAAVGVGGAVREP 180
181 EKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPY 240
241 NCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVK 300
301 IKTEEDEG
Interface Residues: 194, 195, 197, 198, 200, 201, 203, 204, 205, 207, 209, 212, 222, 223, 224, 225, 226, 228, 229, 233, 250, 251, 252, 253, 254, 255, 256, 257, 258, 261, 278, 279, 280, 281, 282, 283, 284, 285, 286, 301
3D-footprint Homologues: 6jnm_A, 7w1m_H, 8cuc_F, 5ei9_F, 1llm_D, 5k5i_A, 6ml4_A, 5v3j_F, 8ssq_A, 1f2i_J, 6blw_A, 5k5l_F, 1tf6_A, 6u9q_A, 4x9j_A, 8ssu_A, 2gli_A, 1g2f_F, 5kkq_D, 7ysf_A, 2lt7_A, 6e94_A, 6a57_A, 2jpa_A, 1ubd_C, 1yuj_A, 2kmk_A, 7n5w_A, 3uk3_C, 1tf3_A, 8gn3_A, 5kl3_A, 7txc_E, 2drp_D, 5yel_A, 8h9h_G, 7y3m_I, 7y3l_A, 2wbs_A, 4m9v_C, 5yj3_D
Binding Motifs: Aef1 CAACAA
M4730_1.02 wGTwGTTG
Publications: Ren B, Maniatis T. Regulation of Drosophila Adh promoter switching by an initiator-targeted repression mechanism. The EMBO journal 17:1076-86 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.