Transcription Factor

Accessions: MAFK_full (HumanTF 1.0)
Names: Erythroid transcription factor NF-E2 p18 subunit, MAFK, MAFK_HUMAN, Transcription factor MafK
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: O60675
Notes: Ensembl ID: ENSG00000198517; Full protein sequence; TF family: bZIP; Clone source: Megaman
Length: 157
Pfam Domains: 23-115 bZIP Maf transcription factor
Sequence:
(in bold interface residues)
1 MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLK 60
61 NRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFART 120
121 VARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS*
Interface Residues: 57, 61, 64, 65, 68, 69, 72
3D-footprint Homologues: 4eot_A, 7x5e_E, 1skn_P, 7x5e_F, 2wt7_B
Binding Motifs: MAFK_full_1 aawwwTGCTGAs
MAFK_full_2 wTGCTGAsTCAGCrw
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.