Transcription Factor
Accessions: | ZFP3 (humanC2H2ZF-ChIP Feb2015), Q96NJ6 (JASPAR 2024) |
Names: | ENSG00000180787, Q96NJ6, ZFP3, Zfp-3, ZFP3_HUMAN, Zinc finger protein 3 homolog, Zinc finger protein 752 |
Organisms: | Homo sapiens |
Libraries: | humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2 1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Notes: | TF family: C2H2 experiment: ChIP-seq/MEME/B1H-RC |
Length: | 502 |
Pfam Domains: | 137-151 Zinc-finger double domain 140-164 C2H2-type zinc finger 141-163 Zinc finger, C2H2 type 141-163 C2H2-type zinc finger 156-180 Zinc-finger double domain 168-189 C2H2-type zinc finger 169-191 Zinc finger, C2H2 type 169-191 C2H2-type zinc finger 183-206 Zinc-finger double domain 197-219 Zinc finger, C2H2 type 215-235 Zinc-finger double domain 224-244 C2H2-type zinc finger 225-247 Zinc finger, C2H2 type 225-247 C2H2-type zinc finger 242-262 Zinc-finger double domain 252-273 C2H2-type zinc finger 253-275 Zinc finger, C2H2 type 253-275 C2H2-type zinc finger 270-292 Zinc-finger double domain 280-301 C2H2-type zinc finger 281-303 Zinc finger, C2H2 type 281-303 C2H2-type zinc finger 296-319 Zinc-finger double domain 309-331 Zinc finger, C2H2 type 309-331 C2H2-type zinc finger 309-329 C2H2-type zinc finger 324-347 Zinc-finger double domain 336-347 C2H2-type zinc finger 337-359 Zinc finger, C2H2 type 337-359 C2H2-type zinc finger 354-374 Zinc-finger double domain 365-379 C2H2-type zinc finger 365-387 Zinc finger, C2H2 type 365-387 C2H2-type zinc finger 380-403 Zinc-finger double domain 392-413 C2H2-type zinc finger 393-415 Zinc finger, C2H2 type 393-415 C2H2-type zinc finger 408-431 Zinc-finger double domain 421-443 C2H2-type zinc finger 436-459 Zinc-finger double domain 448-469 C2H2-type zinc finger 449-471 Zinc finger, C2H2 type 449-471 C2H2-type zinc finger 466-488 Zinc-finger double domain 476-500 C2H2-type zinc finger 477-499 C2H2-type zinc finger 477-499 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 MGTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIE 60 61 QMSPQERDFPSGLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQ 120 121 NFLEILESNKTQRSSVGEKPHTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGT 180 181 NSSLRRHLRIHAGEKPFACNECGKAFIQSSHLIHHHRIHTGERPYKCEECGKAFSQNSAL 240 241 ILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERYHECNECGKAFKHSSGLIRHQ 300 301 KIHTGEKPYLCNECGKGFGQSSELIRHQRIHTGDKPYECNECGKTFGQNSEIIRHIRIHT 360 361 GEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKP 420 421 HQCNECARTFWDNSELLLHQKIHIGEKPYECSECEKTFSQHSQLIIHQRIHTGEKPYECQ 480 481 ECQKTFSRSSHLLRHQSVHCME |
Interface Residues: | 118, 120, 121, 124, 151, 152, 154, 155, 158, 162, 169, 179, 180, 181, 182, 183, 185, 186, 207, 208, 209, 210, 211, 213, 214, 217, 235, 236, 237, 238, 239, 241, 242, 246, 264, 266, 267, 270, 291, 292, 294, 295, 298, 319, 320, 321, 322, 323, 325, 326, 327, 330, 348, 349, 350, 351, 352, 354, 355, 357, 375, 376, 377, 378, 379, 381, 382, 388, 402, 404, 405, 406, 407, 409, 410, 412, 413, 414, 416, 431, 432, 433, 434, 435, 438, 460, 461, 462, 463, 466, 488, 489, 490, 491, 493, 494 |
3D-footprint Homologues: | 6wmi_A, 3uk3_C, 1tf3_A, 1tf6_A, 1llm_D, 8ssu_A, 5kl3_A, 5k5i_A, 1g2f_F, 8ssq_A, 7ysf_A, 2kmk_A, 7w1m_H, 5und_A, 6ml4_A, 8gn3_A, 5yj3_D, 7y3m_I, 6e94_A, 2lt7_A, 1ubd_C, 5v3j_F, 1mey_C, 6u9q_A, 7txc_E, 5k5l_F, 8cuc_F, 7y3l_A, 5yel_A, 6jnm_A, 7n5w_A, 4x9j_A, 2i13_A, 5kkq_D, 5ei9_F, 2drp_D, 1f2i_J, 7eyi_G, 8h9h_G, 4m9v_C, 6a57_A, 6blw_A, 5no6_N, 2wbs_A, 2gli_A, 2jpa_A |
Binding Motifs: | ZFP3_ChIP AACTCCTAy UN0153.1 gyrAACTCCTAytC UN0153.2 rAACTCCTAytC |
Binding Sites: | UN0153.1.1 UN0153.1.10 / UN0153.1.8 UN0153.1.11 / UN0153.1.9 UN0153.1.10 / UN0153.1.12 UN0153.1.11 / UN0153.1.13 UN0153.1.12 / UN0153.1.14 UN0153.1.15 UN0153.1.13 / UN0153.1.16 UN0153.1.14 / UN0153.1.17 UN0153.1.15 / UN0153.1.18 UN0153.1.16 / UN0153.1.19 UN0153.1.2 UN0153.1.17 / UN0153.1.20 UN0153.1.2 / UN0153.1.3 UN0153.1.3 / UN0153.1.4 UN0153.1.4 / UN0153.1.5 UN0153.1.5 / UN0153.1.6 UN0153.1.7 UN0153.1.6 / UN0153.1.8 UN0153.1.7 / UN0153.1.9 UN0153.1.18 UN0153.1.19 UN0153.1.20 UN0153.2.1 UN0153.2.10 / UN0153.2.11 UN0153.2.12 / UN0153.2.16 UN0153.2.13 UN0153.2.14 UN0153.2.15 / UN0153.2.2 UN0153.2.17 UN0153.2.18 / UN0153.2.5 / UN0153.2.9 UN0153.2.19 / UN0153.2.6 UN0153.2.20 UN0153.2.3 UN0153.2.4 UN0153.2.7 UN0153.2.8 |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.