Transcription Factor
| Accessions: | Q8N100 (JASPAR 2024) |
| Names: | ATOH7_HUMAN, Atonal bHLH transcription factor 7, bHLHa13, Class A basic helix-loop-helix protein 13, hATH5, Helix-loop-helix protein hATH-5, Protein atonal homolog 7, Transcription factor ATOH7 |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q8N100 |
| Length: | 152 |
| Pfam Domains: | 41-92 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAF 60 61 DRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDH 120 121 YLPFPGAKLPGESELYSQRLFGFQPEPFQMAT |
| Interface Residues: | 42, 45, 46, 48, 49, 50, 52, 53, 63, 78 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 6od3_F, 5i50_B, 7f2f_B, 7rcu_E, 5eyo_A, 8osl_P, 2ypa_B, 2ql2_A, 2ql2_D, 7ssa_L, 5gnj_I, 4h10_A, 5v0l_B, 5nj8_C, 4x0q_B, 8e24_A |
| Binding Motifs: | MA1468.1 AmCATATGky |
| Publications: | Mao CA, Cho JH, Wang J, Gao Z, Pan P, Tsai WW, Frishman LJ, Klein WH. Reprogramming amacrine and photoreceptor progenitors into retinal ganglion cells by replacing Neurod1 with Atoh7. Development 140:541-51 (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.