Transcription Factor
| Accessions: | 3pvp_B (3D-footprint 20250804), 3pvv_B (3D-footprint 20250804) |
| Names: | Chromosomal replication initiator protein dnaA, DNAA_MYCTA |
| Organisms: | Mycobacterium tuberculosis, strain ATCC 25177 / H37Ra |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | A5TY69 |
| Length: | 95 |
| Pfam Domains: | 4-70 Bacterial dnaA protein helix-turn-helix |
| Sequence: (in bold interface residues) | 1 ISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDH 60 61 TTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS |
| Interface Residues: | 59, 60, 61, 62, 65 |
| 3D-footprint Homologues: | 8btg_B |
| Binding Motifs: | 3pvp_B TTATCCACA 3pvv_B wTGknCmCA |
| Binding Sites: | 3pvp_E 3pvp_F 3pvv_E 3pvv_F |
| Publications: | Tsodikov O.V, Biswas T. Structural and thermodynamic signatures of DNA recognition by Mycobacterium tuberculosis DnaA. Journal of molecular biology 410:461-76 (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.