Transcription Factor

Accessions: 3pvp_B (3D-footprint 20231221), 3pvv_B (3D-footprint 20231221)
Names: Chromosomal replication initiator protein dnaA, DNAA_MYCTA
Organisms: Mycobacterium tuberculosis, strain ATCC 25177 / H37Ra
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: A5TY69
Length: 95
Pfam Domains: 4-70 Bacterial dnaA protein helix-turn-helix
Sequence:
(in bold interface residues)
1 ISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDH 60
61 TTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS
Interface Residues: 26, 50, 59, 60, 61, 64, 65
3D-footprint Homologues: 3pvv_B
Binding Motifs: 3pvp_B TTATCCACA
3pvv_B wTGknCmCA
Binding Sites: 3pvp_E
3pvp_F
3pvv_E
3pvv_F
Publications: Tsodikov O.V, Biswas T. Structural and thermodynamic signatures of DNA recognition by Mycobacterium tuberculosis DnaA. Journal of molecular biology 410:461-76 (2011). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.