Transcription Factor

						

			
Accessions: 1je8_E (3D-footprint 20231221), 1zg5_E (3D-footprint 20231221)

			
Names: NARL_ECOLI, Nitrate/Nitrite Response Regulator Protein NARL
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0AF28
Length: 67
Pfam Domains:      5-60 Bacterial regulatory proteins, luxR family
     5-50 Sigma-70, region 4
     5-49 Sigma-70, region 4
     9-48 Winged helix-turn-helix DNA-binding
Sequence: 
(in bold interface residues)		   1 ERDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVW   60
  61 VHQERIF
Interface Residues: 34, 35, 36, 37, 39, 40, 41, 42, 43, 48, 49, 51, 52, 53
3D-footprint Homologues: 7ve5_B, 4m6f_A, 5w43_B, 4wuh_B, 1je8_F, 1zlk_A, 8dq1_C
Binding Motifs: 1je8_EF TaCCnAnnnnTnGGtA
1zg5_E ThCCmC
1zg5_EF TACCCCtnnAGGGGTA
Binding Sites: 1zg5_G / 1zg5_H
			
Publications: Maris AE., Sawaya MR., Kaczor-Grzeskowiak M., Jarvis MR., Bearson SM., Kopka ML., Schroder I., Gunsalus RP., Dickerson RE. Dimerization allows DNA target site recognition by the NarL response regulator. Nat Struct Biol. 9(10):771-8 (2002). [Pubmed]


Maris AE., Kaczor-Grzeskowiak M., Ma Z., Kopka ML., Gunsalus RP., Dickerson RE. Primary and secondary modes of DNA recognition by the NarL two-component response regulator. Biochemistry. 44(44):14538-52 (2005). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.