Transcription Factor
| Accessions: | 1k79_D (3D-footprint 20260701), 1k7a_D (3D-footprint 20260701) |
| Names: | C-ets-1 protein, ETS1_MOUSE, p54, Protein C-ets-1 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P27577 |
| Length: | 104 |
| Pfam Domains: | 3-84 Ets-domain |
| Sequence: (in bold interface residues) | 1 GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRG 60 61 LRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK |
| Interface Residues: | 33, 37, 38, 41, 55, 56, 58, 59, 60, 62, 63, 77 |
| 3D-footprint Homologues: | 2wbs_A, 3zp5_A, 4mhg_A, 2stt_A, 8smh_F, 4uno_A, 8smj_F, 1dux_F, 7jsa_J, 3jtg_A, 8ee9_F, 1awc_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C |
| Binding Motifs: | 1k79_D CGGAAAnGT 1k7a_D CnTCTCCG |
| Binding Sites: | 1k79_E 1k79_F 1k7a_E 1k7a_F |
| Publications: | Garvie C. W., Hagman J., Wolberger C. Structural studies of Ets-1/Pax5 complex formation on DNA.. Mol. Cell 8:1267-1276 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.