Transcription Factor

Accessions: CEBPE (HT-SELEX2 May2017)
Names: CEBPE, ENSG00000092067
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 143
Pfam Domains: 66-118 Basic region leucine zipper
67-124 bZIP transcription factor
Sequence:
(in bold interface residues)
1 NPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKK 60
61 AVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELD 120
121 TLRNLFRQIPEAANLIKGVGGCS
Interface Residues: 73, 76, 77, 79, 80, 83, 84
3D-footprint Homologues: 8k8c_A, 6mg1_B, 2dgc_A, 5t01_B, 2c9l_Z
Binding Motifs: CEBPE_2 brTTGCGyAAyv
CEBPE_methyl_1 yrTTGCGyAAyv
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.