Transcription Factor
Accessions: | HES7_DBD (HumanTF 1.0), HES7_TF2 (HumanTF2 1.0), HES7 (HT-SELEX2 May2017) |
Names: | bHLH factor Hes7, bHLHb37, Class B basic helix-loop-helix protein 37, Hairy and enhancer of split 7, HES7, HES7_HUMAN, hHes7, Transcription factor HES-7, ENSG00000179111 |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2, HT-SELEX2 May2017 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 3 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | Q9BYE0 |
Notes: | Ensembl ID: ENSG00000179111; DNA-binding domain sequence; TF family: bHLH; Clone source: Gene synthesis, Ensembl ID: ENSG00000179111; Construct type: TF2(3xFLAG); TF family: bHLH; Clone source: Jolma et al. 2013, TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
Length: | 92 |
Pfam Domains: | 16-66 Helix-loop-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 VTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEF 60 61 AVGYLRERSRVEPPGVPRSPVQDAKALASCYL |
Interface Residues: | 19, 20, 23, 24, 52, 54 |
3D-footprint Homologues: | 1an4_A, 4h10_A, 1am9_A, 5nj8_C, 7ssa_L, 8osl_O, 6g1l_A, 1a0a_B, 8osl_P, 4h10_B, 7d8t_A, 5v0l_B |
Binding Motifs: | HES7_DBD yGGCACGTGCCr E2F1_HES7_1 ggCACGTGcCrwtsGCGCsm E2F1_HES7_2 grCrCGTGsyrywaGGCGCsm E2F3_HES7 wwdsGCGCsmwyggCrCGyGbc ERF_HES7_1 rCCGGAAgygcGrCACGyGsc ERF_HES7_2 kkCACGyGCysacCGGAaGt ERF_HES7_2_3 gvCACGTGgyrkmsCGGAAry ETV2_HES7_1 ggCrCGyGsckrcCGGAwry ETV2_HES7_2 rcCGGAAryrrggCrCGYGyc ETV2_HES7_2_3 rsCGGAwrygrhggCrCGyGsc ETV5_HES7_1 smGGAwgcssvgCrCGyG ETV5_HES7_2 gsCrCGyGssbasmGGAwgk GCM2_HES7 rTrckGGyryggCACGyGyc PITX1_HES7_1 rCwCGTGksGGATTA PITX1_HES7_2 rCrcGtGgrkGGATTA PITX1_HES7_2_3 rgCrCGTGbkrsGGATTA RFX3_HES7 TrGCAACssrCACGyGcs TEAD4_HES7_1 GGwATGygkgrcrCGyGy TEAD4_HES7_2 ggwATGyrkgrsrCrCGyGb TEAD4_HES7_2_3 rcATwCCrvCrCGyGys TEAD4_HES7_2_3_4 rmATwCCacmsvCaCGyGys TFAP2C_HES7_1 srCaCGyGycsyrtssCCysrGGs TFAP2C_HES7_2 srCACGyGccywtssCCysrGGs HES7_2 GgCACGyGys HES7_methyl_1 gsCACGyGbv |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.