Transcription Factor

Accessions: HES7_DBD (HumanTF 1.0), HES7_TF2 (HumanTF2 1.0), HES7 (HT-SELEX2 May2017)
Names: bHLH factor Hes7, bHLHb37, Class B basic helix-loop-helix protein 37, Hairy and enhancer of split 7, HES7, HES7_HUMAN, hHes7, Transcription factor HES-7, ENSG00000179111
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2, HT-SELEX2 May2017 3
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
3 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q9BYE0
Notes: Ensembl ID: ENSG00000179111; DNA-binding domain sequence; TF family: bHLH; Clone source: Gene synthesis, Ensembl ID: ENSG00000179111; Construct type: TF2(3xFLAG); TF family: bHLH; Clone source: Jolma et al. 2013, TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 92
Pfam Domains: 16-66 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 VTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEF 60
61 AVGYLRERSRVEPPGVPRSPVQDAKALASCYL
Interface Residues: 19, 20, 23, 24, 52
3D-footprint Homologues: 8ia3_B, 1an4_A, 4h10_A, 1am9_A, 8osl_O, 6g1l_A, 1a0a_B, 8osl_P, 4h10_B, 7d8t_A, 5nj8_C, 5v0l_B
Binding Motifs: HES7_DBD yGGCACGTGCCr
E2F1_HES7_1 ggCACGTGcCrwtsGCGCsm
E2F1_HES7_2 grCrCGTGsyrywaGGCGCsm
E2F3_HES7 wwdsGCGCsmwyggCrCGyGbc
ERF_HES7_1 rCCGGAAgygcGrCACGyGsc
ERF_HES7_2 kkCACGyGCysacCGGAaGt
ERF_HES7_2_3 gvCACGTGgyrkmsCGGAAry
ETV2_HES7_1 ggCrCGyGsckrcCGGAwry
ETV2_HES7_2 rcCGGAAryrrggCrCGYGyc
ETV2_HES7_2_3 rsCGGAwrygrhggCrCGyGsc
ETV5_HES7_1 smGGAwgcssvgCrCGyG
ETV5_HES7_2 gsCrCGyGssbasmGGAwgk
GCM2_HES7 rTrckGGyryggCACGyGyc
PITX1_HES7_1 rCwCGTGksGGATTA
PITX1_HES7_2 rCrcGtGgrkGGATTA
PITX1_HES7_2_3 rgCrCGTGbkrsGGATTA
RFX3_HES7 TrGCAACssrCACGyGcs
TEAD4_HES7_1 GGwATGygkgrcrCGyGy
TEAD4_HES7_2 ggwATGyrkgrsrCrCGyGb
TEAD4_HES7_2_3 rcATwCCrvCrCGyGys
TEAD4_HES7_2_3_4 rmATwCCacmsvCaCGyGys
TFAP2C_HES7_1 srCaCGyGycsyrtssCCysrGGs
TFAP2C_HES7_2 srCACGyGccywtssCCysrGGs
HES7_2 GgCACGyGys
HES7_methyl_1 gsCACGyGbv
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.