Transcription Factor

Accessions: 3u2b_C (3D-footprint 20250804)
Names: SOX4_MOUSE, Transcription factor SOX-4
Organisms: Mus musculus
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q06831
Length: 76
Pfam Domains: 3-71 HMG (high mobility group) box
4-61 Domain of unknown function (DUF1898)
Sequence:
(in bold interface residues)
1 GHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIQEAERLR 60
61 LKHMADYPDYKYRPRK
Interface Residues: 5, 8, 10, 11, 14, 18, 29, 30, 31, 34, 72, 76
3D-footprint Homologues: 7m5w_A, 2gzk_A, 3u2b_C, 1j5n_A, 2lef_A, 4s2q_D, 1o4x_B, 3f27_D, 4y60_C, 1qrv_A, 3tmm_A, 1hry_A, 1ckt_A
Binding Motifs: 3u2b_C cTaTTGT
Binding Sites: 3u2b_A
3u2b_B
Publications: Jauch R, Ng C.K, Narasimhan K, Kolatkar P.R. The crystal structure of the Sox4 HMG domain-DNA complex suggests a mechanism for positional interdependence in DNA recognition. The Biochemical journal 443:39-47 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.