Transcription Factor

						

			
Accessions: 2c9l_Z (3D-footprint 20231221)

			
Names: BZLF1 TRANS-ACTIVATOR PROTEIN, BZLF1_EBVB9, EB1, Trans-activator protein BZLF1, Zebra
Organisms: Epstein-Barr virus (strain B95-8) (HHV-4), Human herpesvirus 4
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03206
Length: 62
Pfam Domains:      2-55 bZIP transcription factor
Sequence: 
(in bold interface residues)		   1 LEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRT   60
  61 PD
Interface Residues: 5, 8, 9, 11, 12, 15, 16
3D-footprint Homologues: 1nwq_C, 6mg1_B, 2c9l_Z
Binding Motifs: 2c9l_YZ TgACTcA
2c9l_Z TgACt
Binding Sites: 2c9l_A
2c9l_B
			
Publications: Petosa C, Morand P, Baudin F, Moulin M, Artero J.B, Müller C.W. Structural basis of lytic cycle activation by the Epstein-Barr virus ZEBRA protein. Molecular cell 21:565-72 (2006). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.