Transcription Factor
Accessions: | UP00478A (UniPROBE 20160601) |
Names: | NONE, PFF0200c_D1 |
Organisms: | Plasmodium falciparum |
Libraries: | UniPROBE 20160601 1 1 Hume MA, Barrera LA, Gisselbrecht SS, Bulyk ML. UniPROBE, update 2015: new tools and content for the online database of protein-binding microarray data on protein-DNA interactions. Nucleic Acids Res : (2015). [Pubmed] |
Description: | putative Plasmodium falciparum transcription factor, tandem double AP2 domain |
Length: | 59 |
Sequence: (in bold interface residues) | 1 IGSQEPVILIDKIERCLVVEWYENNIRREQRISYKKYGNDKAKLRAKELIEKLKSGITF |
Interface Residues: | 39, 42, 43 |
3D-footprint Homologues: | 6en1_A |
Binding Motifs: | UP00478A_1 ytamgArGGGTGCACCyhtcwt |
Publications: | Campbell TL, De Silva EK, Olszewski KL, Elemento O, Llinás M. Identification and genome-wide prediction of DNA binding specificities for the ApiAP2 family of regulators from the malaria parasite. PLoS Pathog : (2010). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.