Transcription Factor

						

			
Accessions: 4hc7_B (3D-footprint 20231221)

			
Names: GATA-binding factor 3, GATA3_HUMAN, Trans-acting T-cell-specific transcription factor GATA-3
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P23771
Length: 97
Pfam Domains:      6-39 GATA zinc finger
    49-81 GATA zinc finger
Sequence: 
(in bold interface residues)		   1 HMGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKGTSCANCQTTTTTLW   60
  61 RRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRN
Interface Residues: 15, 16, 18, 28, 32, 58, 59, 61, 71, 75, 76, 79, 96
3D-footprint Homologues: 4hc9_A, 3vd6_C, 3dfx_B, 1gat_A, 4gat_A
Binding Motifs: 4hc7_B aTCAntGATAA
Binding Sites: 4hc7_Y
4hc7_Z
			
Publications: Chen Y, Bates D.L, Dey R, Chen P.H, Machado A.C, Laird-Offringa I.A, Rohs R, Chen L. DNA binding by GATA transcription factor suggests mechanisms of DNA looping and long-range gene regulation. Cell reports 2:1197-206 (2012). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.