Transcription Factor
Accessions: | CG4360-F1-3 (FlyZincFinger 1.0 ) |
Names: | CG4360 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 108 |
Pfam Domains: | 13-36 C2H2 type zinc-finger (2 copies) 16-35 C2H2-type zinc finger 16-37 C2H2-type zinc finger 16-37 Zinc finger, C2H2 type 30-53 Zinc-finger double domain 42-61 C2H2-type zinc finger 43-65 Zinc finger, C2H2 type 43-65 C2H2-type zinc finger 58-81 Zinc-finger double domain 70-94 C2H2-type zinc finger 71-93 Zinc finger, C2H2 type 71-93 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 ISEEEVVVDDPRKKKQCHVCKNKFRQLTTLRNHMKIHTDERPYKCKHCDKAFRQISTLTN 60 61 HVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNYQ |
Interface Residues: | 25, 26, 27, 28, 29, 31, 32, 34, 35, 38, 53, 54, 55, 56, 57, 59, 60, 61, 68, 81, 82, 83, 84, 85, 86, 87, 88, 89, 92 |
3D-footprint Homologues: | 7n5w_A, 6jnm_A, 1tf3_A, 7w1m_H, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 2gli_A, 1g2f_F, 5kkq_D, 1ubd_C, 5ei9_F, 5kl3_A, 2kmk_A, 7ysf_A, 8h9h_G, 5v3j_F, 2lt7_A, 6e94_A, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 3uk3_C, 5k5l_F, 5yel_A, 2wbs_A, 8gn3_A, 1llm_D, 7txc_E, 5k5i_A, 6ml4_A, 2drp_D, 8ssq_A, 1f2i_J, 4m9v_C, 7y3m_I, 1yuj_A, 5yj3_D |
Binding Motifs: | CG4360-F1-3_SOLEXA_FBgn0038787 ktTGTTGTTGTwrtt |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.